Property Summary

NCBI Gene PubMed Count 17
PubMed Score 15.01
PubTator Score 6.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease 1.147 3.3e-03
adult high grade glioma 2.300 4.8e-05
astrocytoma 1.600 8.2e-17
Astrocytoma, Pilocytic 2.600 6.5e-10
ependymoma 1.800 2.2e-08
glioblastoma 2.300 6.6e-10
group 4 medulloblastoma -1.200 9.7e-03
inflammatory breast cancer 1.100 1.5e-03
intraductal papillary-mucinous neoplasm ... 1.300 2.0e-02
juvenile dermatomyositis 3.231 1.6e-21
Multiple Sclerosis 1.400 5.7e-03
oligodendroglioma 1.300 3.1e-11
ovarian cancer 1.900 9.6e-05
primary pancreatic ductal adenocarcinoma 1.095 1.5e-02
primary Sjogren syndrome 1.300 3.6e-03
psoriasis 1.500 1.1e-125
subependymal giant cell astrocytoma 2.762 2.6e-03

Gene RIF (10)

AA Sequence

MASHLRPPSPLLVRVYKSGPRVRRKLESYFQSSKSSGGGECTVSTQEHEAPGTFRVEFSERAAKERVLKK      1 - 70
GEHQILVDEKPVPIFLVPTENSIKKNTRPQISSLTQSQAETPSGDMHQHEGHIPNAVDSCLQKIFLTVTA     71 - 140
DLNCNLFSKEQRAYITTLCPSIRKMEGHDGIEKVCGDFQDIERIHQFLSEQFLESEQKQQFSPSMTERKP    141 - 210
LSQQERDSCISPSEPETKAEQKSNYFEVPLPYFEYFKYICPDKINSIEKRFGVNIEIQESSPNMVCLDFT    211 - 280
SSRSGDLEAARESFASEFQKNTEPLKQECVSLADSKQANKFKQELNHQFTKLLIKEKGGELTLLGTQDDI    281 - 350
SAAKQKISEAFVKIPVKLFAANYMMNVIEVDSAHYKLLETELLQEISEIEKRYDICSKVSEKGQKTCILF    351 - 420
ESKDRQVDLSVHAYASFIDAFQHASCQLMREVLLLKSLGKERKHLHQTKFADDFRKRHPNVHFVLNQESM    421 - 490
TLTGLPNHLAKAKQYVLKGGGMSSLAGKKLKEGHETPMDIDSDDSKAASPPLKGSVSSEASELDKKEKGI    491 - 560
CVICMDTISNKKVLPKCKHEFCAPCINKAMSYKPICPTCQTSYGIQKGNQPEGSMVFTVSRDSLPGYESF    561 - 630
GTIVITYSMKAGIQTEEHPNPGKRYPGIQRTAYLPDNKEGRKVLKLLYRAFDQKLIFTVGYSRVLGVSDV    631 - 700
ITWNDIHHKTSRFGGPEMYGYPDPSYLKRVKEELKAKGIE                                  701 - 740
//

Text Mined References (25)

PMID Year Title