Property Summary

NCBI Gene PubMed Count 22
Grant Count 5
R01 Count 1
Funding $754,755.13
PubMed Score 12.95
PubTator Score 12.10

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (12)

PMID Text
26439168 KLF14 transcription is significantly downregulated, whereas Plk4 transcription is upregulated in multiple types of cancers, and there exists an inverse correlation between KLF14 and Plk4 protein expression in human breast and colon cancers.
26368306 Transduction of HepG2 cells with human KLF14 showed that KLF14 is a regulator of APOA1 expression.
26226221 KLF14 plays an important role in increasing glucose uptake and insulin sensitivity by the activation of PI3-kinase/Akt signaling pathway in vitro.
24759103 This is the first description of the activity and mechanisms underlying the function of KLF14 as an activator protein and novel regulator of lipid signaling.
24486580 The risk allele C of rs151290 in KCNQ1 and risk allele G of rs972283 in KLF14 were both associated with increased risk of T2DM in a global population.
24195066 The objective of the present study was to detect the association of the rs4731702 single nucleotide polymorphism (SNP) and serum lipid levels in the Guangxi Mulao and Han populations.
21572415 we show that the type 2 diabetes and high-density lipoprotein cholesterol-associated cis-acting expression quantitative trait locus (eQTL) of the maternally expressed transcription factor KLF14 acts as a master trans regulator of adipose gene expression
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19936222 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19578363 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSAAVACLDYFAAECLVSMSAGAVVHRRPPDPEGAGGAAGSEVGAAHPESALPGPGPSGPASVPQLPQVP      1 - 70
APSPGAGGAAPHLLAASVWADLRGSSGEGSWENSGEAPRASSGFSDPIPCSVQTPCSELAPASGAAAVCA     71 - 140
PESSSDAPAVPSAPAAPGAPAASGGFSGGALGAGPAPAADQAPRRRSVTPAAKRHQCPFPGCTKAYYKSS    141 - 210
HLKSHQRTHTGERPFSCDWLDCDKKFTRSDELARHYRTHTGEKRFSCPLCPKQFSRSDHLTKHARRHPTY    211 - 280
HPDMIEYRGRRRTPRIDPPLTSEVESSASGSGPGPAPSFTTCL                               281 - 323
//

Text Mined References (22)

PMID Year Title
26439168 2015 Loss of KLF14 triggers centrosome amplification and tumorigenesis.
26368306 2015 Perhexiline activates KLF14 and reduces atherosclerosis by modulating ApoA-I production.
26226221 2015 Krüppel-like factor 14 increases insulin sensitivity through activation of PI3K/Akt signal pathway.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
24759103 2014 New role for Kruppel-like factor 14 as a transcriptional activator involved in the generation of signaling lipids.
24486580 2014 Association of KCNQ1 and KLF14 polymorphisms and risk of type 2 diabetes mellitus: A global meta-analysis.
24403052 2014 Germline sequence variants in TGM3 and RGS22 confer risk of basal cell carcinoma.
24195066 2013 Association of the KLF14 rs4731702 SNP and serum lipid levels in the Guangxi Mulao and Han populations.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23630301 2013 Strong parent-of-origin effects in the association of KCNQ1 variants with type 2 diabetes in American Indians.
More...