Property Summary

NCBI Gene PubMed Count 24
PubMed Score 17.66
PubTator Score 12.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 6.2e-23
ovarian cancer 8520 3.3e-07
osteosarcoma 7950 2.3e-04
atypical teratoid / rhabdoid tumor 5112 1.1e-03
Disease Target Count Z-score Confidence
diabetes mellitus 1728 3.132 1.6

Expression

Gene RIF (13)

AA Sequence

MSAAVACLDYFAAECLVSMSAGAVVHRRPPDPEGAGGAAGSEVGAAHPESALPGPGPSGPASVPQLPQVP      1 - 70
APSPGAGGAAPHLLAASVWADLRGSSGEGSWENSGEAPRASSGFSDPIPCSVQTPCSELAPASGAAAVCA     71 - 140
PESSSDAPAVPSAPAAPGAPAASGGFSGGALGAGPAPAADQAPRRRSVTPAAKRHQCPFPGCTKAYYKSS    141 - 210
HLKSHQRTHTGERPFSCDWLDCDKKFTRSDELARHYRTHTGEKRFSCPLCPKQFSRSDHLTKHARRHPTY    211 - 280
HPDMIEYRGRRRTPRIDPPLTSEVESSASGSGPGPAPSFTTCL                               281 - 323
//

Text Mined References (24)

PMID Year Title