Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.08
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Carcinoma 2,147 1.0

Expression

Synonym

Accession Q8TD91 Q3SYA7 Q5JZ43 Q9BZ80
Symbols HCA2
CT7.2
MAGEC4
MAGE-C3

Gene

PANTHER Protein Class (1)

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
26857816 The data support an important role for prostaglandin activation of sAC and PKA in H2O2-induced barrier disruption.

AA Sequence

MLLPCHWVLDATFSDGSLGQWVKNTCATYALSPVVLPPQPQPRKKATDKDYSAFHLGHLREVRLFLRGGT      1 - 70
SDQRMDSLVLCPTYFKLWRTLSGSPGLQLSDLHFGSQPEGKFSLRRAVSVKQREEPQDWPLNEKRTLWKD     71 - 140
SDLPTWRRGTGYTLSLPAVSPGKRLWGEKAGSLPESEPLFTYTLDEKVDKLVQFLLLKYQAKEPLTRAEM    141 - 210
QMNVINTYTGYFPMIFRKAREFIEILFGISLTEVDPDHFYVFVNTLDLTCEGSLSDEQGMPQNRLLILIL    211 - 280
SVIFIKGNCASEEVIWEVLNAIGPWSALAGFADVLSRLALWESEGPEAFCEESGLRSAEGSVLDLANPQG    281 - 350
LAGHRQEDGRRGLTEASPQQKKGGEDEDMPAAGMPPLPQSPPEIPPQGPPKISPQGPPQSPPQSPLDSCS    351 - 420
SPLLWTRLDEESSSEEEDTATWHALPESESLPRYALDEKVAELVQFLLLKYQTKEPVTKAEMLTTVIKKY    421 - 490
KDYFPMIFGKAHEFIELIFGIALTDMDPDNHSYFFEDTLDLTYEGSLIDDQGMPKNCLLILILSMIFIKG    491 - 560
SCVPEEVIWEVLSAIGPIQRPAREVLEFLSKLSSIIPSAFPSWYMDALKDMEDRAQAIIDTTDDATAMAS    561 - 630
ASPSVMSTNFCPE                                                             631 - 643
//

Text Mined References (6)

PMID Year Title
26857816 2016 Soluble adenylyl cyclase mediates hydrogen peroxide-induced changes in epithelial barrier function.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10861452 2000 MAGE-B5, MAGE-B6, MAGE-C2, and MAGE-C3: four new members of the MAGE family with tumor-specific expression.