Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.50
PubTator Score 3.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8TD86 A2A2M3 Q6Q2C4
Symbols CAGLP

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Platypus OMA EggNOG

Gene RIF (1)

PMID Text
15621662 a novel human gene, CAGLP (calglandulin-like protein) was predicted, and subsequently isolated from human skeleton muscle

AA Sequence

MGLQQEISLQPWCHHPAESCQTTTDMTERLSAEQIKEYKGVFEMFDEEGNGEVKTGELEWLMSLLGINPT      1 - 70
KSELASMAKDVDRDNKGFFNCDGFLALMGVYHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAG     71 - 140
EPLNEVEAEQMMKEADKDGDRTIDYEEFVAMMTGESFKLIQ                                 141 - 181
//

Text Mined References (4)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15621662 Cloning and characterization of human CAGLP gene encoding a novel EF-hand protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.