Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.11
PubTator Score 3.75

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MGLQQEISLQPWCHHPAESCQTTTDMTERLSAEQIKEYKGVFEMFDEEGNGEVKTGELEWLMSLLGINPT      1 - 70
KSELASMAKDVDRDNKGFFNCDGFLALMGVYHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAG     71 - 140
EPLNEVEAEQMMKEADKDGDRTIDYEEFVAMMTGESFKLIQ                                 141 - 181
//

Text Mined References (4)

PMID Year Title