Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.50
PubTator Score 3.75

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
15621662 a novel human gene, CAGLP (calglandulin-like protein) was predicted, and subsequently isolated from human skeleton muscle

AA Sequence

MGLQQEISLQPWCHHPAESCQTTTDMTERLSAEQIKEYKGVFEMFDEEGNGEVKTGELEWLMSLLGINPT      1 - 70
KSELASMAKDVDRDNKGFFNCDGFLALMGVYHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAG     71 - 140
EPLNEVEAEQMMKEADKDGDRTIDYEEFVAMMTGESFKLIQ                                 141 - 181
//

Text Mined References (4)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15621662 Cloning and characterization of human CAGLP gene encoding a novel EF-hand protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.