Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.36
PubTator Score 2.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession Q8TD47 A6NIR6
Symbols RPS4Y2P

Gene

Gene RIF (1)

PMID Text
20459660 One of the Y-linked copies of the ribosomal protein S4 is expressed during spermatogenesis and germ cell development and the C-terminus of the protein has some degree of functional specialisation of this protein in spermatogenesis.

AA Sequence

MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQHFL      1 - 70
KIDGKVRVDITYPAGFIDVISIEKTGEHFRLVYNTKGCFAVHRITVEEAKYKLCKVRKITVGTKGIPHLV     71 - 140
THDARTIRYPDPLIKVNDTVQIDLGTGKITSFIKFDTGNVCMVIAGANLGRVGVITNRERHPGSCDVVHV    141 - 210
KDANGNSFATRISNIFVIGNGNKPWISLPRGKGIRLTIAEERDKRLAAKQSSG                     211 - 263
//

Text Mined References (3)

PMID Year Title
22708584 2012 Primer-BLAST: a tool to design target-specific primers for polymerase chain reaction.
20459660 2010 The human RPS4 paralogue on Yq11.223 encodes a structurally conserved ribosomal protein and is preferentially expressed during spermatogenesis.
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.