Property Summary

NCBI Gene PubMed Count 48
PubMed Score 83.58
PubTator Score 49.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma 1.200 1.7e-03
medulloblastoma, large-cell 1.500 1.6e-04
mucosa-associated lymphoid tissue lympho... 1.761 2.6e-02
Rhinitis 1.300 4.6e-03
uncontrolled asthma 1.500 2.7e-03

Gene RIF (37)

AA Sequence

MLCPWRTANLGLLLILTIFLVAASSSLCMDEKQITQNYSKVLAEVNTSWPVKMATNAVLCCPPIALRNLI      1 - 70
IITWEIILRGQPSCTKAYRKETNETKETNCTDERITWVSRPDQNSDLQIRPVAITHDGYYRCIMVTPDGN     71 - 140
FHRGYHLQVLVTPEVTLFQNRNRTAVCKAVAGKPAAQISWIPEGDCATKQEYWSNGTVTVKSTCHWEVHN    141 - 210
VSTVTCHVSHLTGNKSLYIELLPVPGAKKSAKLYIPYIILTIIILTIVGFIWLLKVNGCRKYKLNKTEST    211 - 280
PVVEEDEMQPYASYTEKNNPLYDTTNKVKASEALQSEVDTDLHTL                             281 - 325
//

Text Mined References (53)

PMID Year Title