Property Summary

NCBI Gene PubMed Count 51
Grant Count 63
R01 Count 48
Funding $7,177,406.63
PubMed Score 137.90
PubTator Score 108.73

Knowledge Summary

Patent (13,257)

Expression

  Differential Expression (4)

Synonym

Accession Q8TD43 A2RU25 Q7Z5D9 Q96L84 Q9NXV1 hTRPM4
Symbols LTrpC4
PFHB1B
TRPM4B
hTRPM4

Gene

PANTHER Protein Class (2)

Gene RIF (32)

PMID Text
26791488 TRPM4 channels regulate human detrusor smooth muscle excitability and contractility and are critical determinants of human urinary bladder function
26590985 TRPM4 protein expression is widely expressed in benign and cancerous prostate tissue
26571400 The PKC-dependent effect of GLP-1 on membrane potential and electrical activity was mediated by activation of Na(+)-permeable TRPM4 and TRPM5 channels by mobilization of intracellular Ca(2+) from thapsigargin-sensitive Ca(2+) stores
26496025 Identify TRPM4 as a regulator of store operated calcium entry in prostate tumor cells, and demonstrate a role for TRPM4 in cancer cell migration.
26172285 these data suggest an important role for the Sur1-Trpm4 channel in the pathophysiology of postischemic cell death
26110647 we demonstrate that the inhibition of TRPM4 activity alters cellular contractility in vivo, affecting cutaneous wound healing.
26071843 new insight into the ligand binding domains of the TRPM4 channel
25909699 TRPM4 acts to maintain endothelial features and its loss promotes fibrotic conversion via TGF-beta production.
25231975 Casein kinase 1 phosphorylates S839 and is responsible for the basolateral localization of TRPM4.
25047048 These results showed that the cell surface expression of TRPM4 channels is mediated by 14-3-3gamma binding.
More...

AA Sequence

MVVPEKEQSWIPKIFKKKTCTTFIVDSTDPGGTLCQCGRPRTAHPAVAMEDAFGAAVVTVWDSDAHTTEK      1 - 70
PTDAYGELDFTGAGRKHSNFLRLSDRTDPAAVYSLVTRTWGFRAPNLVVSVLGGSGGPVLQTWLQDLLRR     71 - 140
GLVRAAQSTGAWIVTGGLHTGIGRHVGVAVRDHQMASTGGTKVVAMGVAPWGVVRNRDTLINPKGSFPAR    141 - 210
YRWRGDPEDGVQFPLDYNYSAFFLVDDGTHGCLGGENRFRLRLESYISQQKTGVGGTGIDIPVLLLLIDG    211 - 280
DEKMLTRIENATQAQLPCLLVAGSGGAADCLAETLEDTLAPGSGGARQGEARDRIRRFFPKGDLEVLQAQ    281 - 350
VERIMTRKELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDIAQSELFRGDIQW    351 - 420
RSFHLEASLMDALLNDRPEFVRLLISHGLSLGHFLTPMRLAQLYSAAPSNSLIRNLLDQASHSAGTKAPA    421 - 490
LKGGAAELRPPDVGHVLRMLLGKMCAPRYPSGGAWDPHPGQGFGESMYLLSDKATSPLSLDAGLGQAPWS    491 - 560
DLLLWALLLNRAQMAMYFWEMGSNAVSSALGACLLLRVMARLEPDAEEAARRKDLAFKFEGMGVDLFGEC    561 - 630
YRSSEVRAARLLLRRCPLWGDATCLQLAMQADARAFFAQDGVQSLLTQKWWGDMASTTPIWALVLAFFCP    631 - 700
PLIYTRLITFRKSEEEPTREELEFDMDSVINGEGPVGTADPAEKTPLGVPRQSGRPGCCGGRCGGRRCLR    701 - 770
RWFHFWGAPVTIFMGNVVSYLLFLLLFSRVLLVDFQPAPPGSLELLLYFWAFTLLCEELRQGLSGGGGSL    771 - 840
ASGGPGPGHASLSQRLRLYLADSWNQCDLVALTCFLLGVGCRLTPGLYHLGRTVLCIDFMVFTVRLLHIF    841 - 910
TVNKQLGPKIVIVSKMMKDVFFFLFFLGVWLVAYGVATEGLLRPRDSDFPSILRRVFYRPYLQIFGQIPQ    911 - 980
EDMDVALMEHSNCSSEPGFWAHPPGAQAGTCVSQYANWLVVLLLVIFLLVANILLVNLLIAMFSYTFGKV    981 - 1050
QGNSDLYWKAQRYRLIREFHSRPALAPPFIVISHLRLLLRQLCRRPRSPQPSSPALEHFRVYLSKEAERK   1051 - 1120
LLTWESVHKENFLLARARDKRESDSERLKRTSQKVDLALKQLGHIREYEQRLKVLEREVQQCSRVLGWVA   1121 - 1190
EALSRSALLPPGGPPPPDLPGSKD                                                 1191 - 1214
//

Text Mined References (51)

PMID Year Title
27207958 2016 Variants of Transient Receptor Potential Melastatin Member 4 in Childhood Atrioventricular Block.
26791488 2016 Novel regulatory mechanism in human urinary bladder: central role of transient receptor potential melastatin 4 channels in detrusor smooth muscle function.
26590985 2016 TRPM4 protein expression in prostate cancer: a novel tissue biomarker associated with risk of biochemical recurrence following radical prostatectomy.
26571400 2015 GLP-1 stimulates insulin secretion by PKC-dependent TRPM4 and TRPM5 activation.
26496025 2015 Transient receptor potential melastatin 4 channel contributes to migration of androgen-insensitive prostate cancer cells.
26172285 2015 Sur1-Trpm4 Cation Channel Expression in Human Cerebral Infarcts.
26110647 2015 TRPM4 Is a Novel Component of the Adhesome Required for Focal Adhesion Disassembly, Migration and Contractility.
26071843 2015 PIP2 and PIP3 interact with N-terminus region of TRPM4 channel.
25909699 2015 Suppression of transient receptor potential melastatin 4 expression promotes conversion of endothelial cells into fibroblasts via transforming growth factor/activin receptor-like kinase 5 pathway.
25231975 2015 Casein kinase-mediated phosphorylation of serine 839 is necessary for basolateral localization of the Ca²?-activated non-selective cation channel TRPM4.
More...