Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Common cold 63 3.52 1.8

Expression

AA Sequence

MKGSRALLLVALTLFCICRMATGEDNDEFFMDFLQTLLVGTPEELYEGTLGKYNVNEDAKAAMTELKSCI      1 - 70
DGLQPMHKAELVKLLVQVLGSQDGA                                                  71 - 95
//

Text Mined References (5)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12406855 2002 Secretoglobins SCGB3A1 and SCGB3A2 define secretory cell subsets in mouse and human airways.
11181995 2001 The sequence of the human genome.
9847074 1998 Toward a complete human genome sequence.