Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Common cold 67 3.498 1.7

Expression

AA Sequence

MKGSRALLLVALTLFCICRMATGEDNDEFFMDFLQTLLVGTPEELYEGTLGKYNVNEDAKAAMTELKSCI      1 - 70
DGLQPMHKAELVKLLVQVLGSQDGA                                                  71 - 95
//

Text Mined References (5)

PMID Year Title