Property Summary

NCBI Gene PubMed Count 40
PubMed Score 9.58
PubTator Score 104.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -1.100 0.002
osteosarcoma -1.682 0.000
ovarian cancer 1.100 0.000

Synonym

Gene

Gene RIF (19)

PMID Text
24858563 Confocal imaging confirmed the localization of CCHCR1 in P-bodies.
24664238 CCHCR1 interacts specifically with the E2 protein of human papillomavirus type 16 on a surface overlapping BRD4 binding
23189171 The centrosomal localization of CCHCR1 provides a connection to the abnormal cell proliferation and offers a link to possible cellular pathways altered in psoriasis.
22182809 Psoriasis is associated with genetic polymorphism in the CCHCR1 gene and in a genomic segment flanking the HLA-C region in the North Indian population.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19551138 CCHCR1 is up-regulated in skin cancer and associated with EGFR expression
19242354 Observational study of gene-disease association. (HuGE Navigator)
18174193 the aberrant function of CCHCR1 may lead to abnormal keratinocyte proliferation which is a key feature of psoriatic epidermis.
17530646 Observational study of gene-disease association. (HuGE Navigator)
17340018 Observational study of gene-disease association. (HuGE Navigator)
17340018 Results show that HLA-Cw6 and CCHCR1 risk allele associations with clinical features of psoriasis are predictably highly similar in a Finnish nationwide cohort of 379 psoriasis patients.
17221218 These results suggest a role for CCHCR1 in the pathogenesis of psoriasis via the regulation of skin steroid metabolism.
17179747 These studies show that miR-122, a 22-nucleotide microRNA, is derived from a liver-specific noncoding polyadenylated RNA transcribed from the gene hcr.
15654960 Observational study of gene-disease association. (HuGE Navigator)
15539411 Observational study of gene-disease association. (HuGE Navigator)
15214895 Observational study of gene-disease association. (HuGE Navigator)
12909641 Isolated by a two hybrid assay, StAR binding protein binds StAR protein in cells and enhances the ability of StAR protein to promote syntheses of steroid hormones.(sTAR binding protein)
11348465 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFPPSGSTGLIPPSHFQARPLSTLPRMAPTWLSDIPLVQPPGHQDVSERRLDTQRPQVTMWERDVSSDRQ      1 - 70
EPGRRGRSWGLEGSQALSQQAEVIVRQLQELRRLEEEVRLLRETSLQQKMRLEAQAMELEALARAEKAGR     71 - 140
AEAEGLRAALAGAEVVRKNLEEGSQRELEEVQRLHQEQLSSLTQAHEEALSSLTSKAEGLEKSLSSLETR    141 - 210
RAGEAKELAEAQREAELLRKQLSKTQEDLEAQVTLVENLRKYVGEQVPSEVHSQTWELERQKLLETMQHL    211 - 280
QEDRDSLHATAELLQVRVQSLTHILALQEEELTRKVQPSDSLEPEFTRKCQSLLNRWREKVFALMVQLKA    281 - 350
QELEHSDSVKQLKGQVASLQEKVTSQSQEQAILQRSLQDKAAEVEVERMGAKGLQLELSRAQEARRRWQQ    351 - 420
QTASAEEQLRLVVNAVSSSQIWLETTMAKVEGAAAQLPSLNNRLSYAVRKVHTIRGLIARKLALAQLRQE    421 - 490
SCPLPPPVTDVSLELQQLREERNRLDAELQLSARLIQQEVGRAREQGEAERQQLSKVAQQLEQELQQTQE    491 - 560
SLASLGLQLEVARQGQQESTEEAASLRQELTQQQELYGQALQEKVAEVETRLREQLSDTERRLNEARREH    561 - 630
AKAVVSLRQIQRRAAQEKERSQELRRLQEEARKEEGQRLARRLQELERDKNLMLATLQQEGLLSRYKQQR    631 - 700
LLTVLPSLLDKKKSVVSSPRPPECSASAPVAAAVPTRESIKGSLSVLLDDLQDLSEAISKEEAVCQGDNL    701 - 770
DRCSSSNPQMSS                                                              771 - 782
//

Text Mined References (42)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24858563 2014 CCHCR1 interacts with EDC4, suggesting its localization in P-bodies.
24664238 2014 CCHCR1 interacts specifically with the E2 protein of human papillomavirus type 16 on a surface overlapping BRD4 binding.
23955597 2013 Common variation at 3q26.2, 6p21.33, 17p11.2 and 22q13.1 influences multiple myeloma risk.
23644468 2013 CEP162 is an axoneme-recognition protein promoting ciliary transition zone assembly at the cilia base.
23263863 2013 GWAS of blood cell traits identifies novel associated loci and epistatic interactions in Caucasian and African-American children.
23189171 2012 Centrosomal localization of the psoriasis candidate gene product, CCHCR1, supports a role in cytoskeletal organization.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
22182809 2011 Psoriasis-associated genetic polymorphism in North Indian population in the CCHCR1 gene and in a genomic segment flanking the HLA-C region.
21912425 2013 A whole-genome association study of major determinants for allopurinol-related Stevens-Johnson syndrome and toxic epidermal necrolysis in Japanese patients.
21810746 2011 Genome-wide association study identifies variations in 6p21.3 associated with nevirapine-induced rash.
21743467 2011 Seven prostate cancer susceptibility loci identified by a multi-stage genome-wide association study.
21738480 2011 Multiple loci are associated with white blood cell phenotypes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19915573 2009 A genome-wide association study identifies three new susceptibility loci for ulcerative colitis in the Japanese population.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19551138 2009 CCHCR1 is up-regulated in skin cancer and associated with EGFR expression.
19242354 2009 The tumor necrosis factor polymorphism TNF (-308) is associated with susceptibility to meningococcal sepsis, but not with lethality.
18305892 2008 Search for cellular partners of human papillomavirus type 16 E2 protein.
18174193 2008 The PSORS1 locus gene CCHCR1 affects keratinocyte proliferation in transgenic mice.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17530646 2007 TNF polymorphisms in psoriasis: association of psoriatic arthritis with the promoter polymorphism TNF*-857 independent of the PSORS1 risk allele.
17340018 2007 Clinical associations of the risk alleles of HLA-Cw6 and CCHCR1*WWCC in psoriasis.
17221218 2007 The CCHCR1 (HCR) gene is relevant for skin steroidogenesis and downregulated in cultured psoriatic keratinocytes.
17179747 2004 miR-122, a mammalian liver-specific microRNA, is processed from hcr mRNA and may downregulate the high affinity cationic amino acid transporter CAT-1.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15654960 2005 The major psoriasis susceptibility locus PSORS1 is not a risk factor for late-onset psoriasis.
15539411 2005 Lack of genetic association of the three more common polymorphisms of CARD15 with psoriatic arthritis and psoriasis in a German cohort.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15214895 2004 Genetic polymorphisms of the HCR gene and a genomic segment in close proximity to HLA-C are associated with patients with psoriasis in Taiwan.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14675183 2003 HCR, a candidate gene for psoriasis, is expressed differently in psoriasis and other hyperproliferative skin disorders and is downregulated by interferon-gamma in keratinocytes.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12909641 2003 Steroidogenic acute regulatory protein-binding protein cloned by a yeast two-hybrid system.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12023963 2002 Involvement of TRAF4 in oxidative activation of c-Jun N-terminal kinase.
11875053 2002 Coding haplotype analysis supports HCR as the putative susceptibility gene for psoriasis at the MHC PSORS1 locus.
11348465 2001 The HCR gene on 6p21 is unlikely to be a psoriasis susceptibility gene.
10888604 2000 A candidate gene for psoriasis near HLA-C, HCR (Pg8), is highly polymorphic with a disease-associated susceptibility allele.
10545595 1999 Association analysis using refined microsatellite markers localizes a susceptibility locus for psoriasis vulgaris within a 111 kb segment telomeric to the HLA-C gene.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.