Property Summary

NCBI Gene PubMed Count 41
PubMed Score 9.98
PubTator Score 104.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Amphetamine-Related Disorders 72 0.0 0.0
Prostatic Neoplasms 472 0.0 0.0
Disease Target Count P-value
ovarian cancer 8297 1.8e-08
osteosarcoma 7766 7.7e-07
psoriasis 6514 1.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7
Disease Target Count Z-score Confidence
Peeling skin syndrome 17 4.517 2.3

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -1.100 1.6e-03
osteosarcoma -1.682 7.7e-07
ovarian cancer 1.100 1.8e-08

Gene RIF (19)

AA Sequence

MFPPSGSTGLIPPSHFQARPLSTLPRMAPTWLSDIPLVQPPGHQDVSERRLDTQRPQVTMWERDVSSDRQ      1 - 70
EPGRRGRSWGLEGSQALSQQAEVIVRQLQELRRLEEEVRLLRETSLQQKMRLEAQAMELEALARAEKAGR     71 - 140
AEAEGLRAALAGAEVVRKNLEEGSQRELEEVQRLHQEQLSSLTQAHEEALSSLTSKAEGLEKSLSSLETR    141 - 210
RAGEAKELAEAQREAELLRKQLSKTQEDLEAQVTLVENLRKYVGEQVPSEVHSQTWELERQKLLETMQHL    211 - 280
QEDRDSLHATAELLQVRVQSLTHILALQEEELTRKVQPSDSLEPEFTRKCQSLLNRWREKVFALMVQLKA    281 - 350
QELEHSDSVKQLKGQVASLQEKVTSQSQEQAILQRSLQDKAAEVEVERMGAKGLQLELSRAQEARRRWQQ    351 - 420
QTASAEEQLRLVVNAVSSSQIWLETTMAKVEGAAAQLPSLNNRLSYAVRKVHTIRGLIARKLALAQLRQE    421 - 490
SCPLPPPVTDVSLELQQLREERNRLDAELQLSARLIQQEVGRAREQGEAERQQLSKVAQQLEQELQQTQE    491 - 560
SLASLGLQLEVARQGQQESTEEAASLRQELTQQQELYGQALQEKVAEVETRLREQLSDTERRLNEARREH    561 - 630
AKAVVSLRQIQRRAAQEKERSQELRRLQEEARKEEGQRLARRLQELERDKNLMLATLQQEGLLSRYKQQR    631 - 700
LLTVLPSLLDKKKSVVSSPRPPECSASAPVAAAVPTRESIKGSLSVLLDDLQDLSEAISKEEAVCQGDNL    701 - 770
DRCSSSNPQMSS                                                              771 - 782
//

Text Mined References (43)

PMID Year Title