Property Summary

NCBI Gene PubMed Count 40
PubMed Score 9.58
PubTator Score 104.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -1.100 0.002
osteosarcoma -1.682 0.000
ovarian cancer 1.100 0.000

Synonym

Gene

Gene RIF (19)

PMID Text
24858563 Confocal imaging confirmed the localization of CCHCR1 in P-bodies.
24664238 CCHCR1 interacts specifically with the E2 protein of human papillomavirus type 16 on a surface overlapping BRD4 binding
23189171 The centrosomal localization of CCHCR1 provides a connection to the abnormal cell proliferation and offers a link to possible cellular pathways altered in psoriasis.
22182809 Psoriasis is associated with genetic polymorphism in the CCHCR1 gene and in a genomic segment flanking the HLA-C region in the North Indian population.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19551138 CCHCR1 is up-regulated in skin cancer and associated with EGFR expression
19242354 Observational study of gene-disease association. (HuGE Navigator)
18174193 the aberrant function of CCHCR1 may lead to abnormal keratinocyte proliferation which is a key feature of psoriatic epidermis.
17530646 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MFPPSGSTGLIPPSHFQARPLSTLPRMAPTWLSDIPLVQPPGHQDVSERRLDTQRPQVTMWERDVSSDRQ      1 - 70
EPGRRGRSWGLEGSQALSQQAEVIVRQLQELRRLEEEVRLLRETSLQQKMRLEAQAMELEALARAEKAGR     71 - 140
AEAEGLRAALAGAEVVRKNLEEGSQRELEEVQRLHQEQLSSLTQAHEEALSSLTSKAEGLEKSLSSLETR    141 - 210
RAGEAKELAEAQREAELLRKQLSKTQEDLEAQVTLVENLRKYVGEQVPSEVHSQTWELERQKLLETMQHL    211 - 280
QEDRDSLHATAELLQVRVQSLTHILALQEEELTRKVQPSDSLEPEFTRKCQSLLNRWREKVFALMVQLKA    281 - 350
QELEHSDSVKQLKGQVASLQEKVTSQSQEQAILQRSLQDKAAEVEVERMGAKGLQLELSRAQEARRRWQQ    351 - 420
QTASAEEQLRLVVNAVSSSQIWLETTMAKVEGAAAQLPSLNNRLSYAVRKVHTIRGLIARKLALAQLRQE    421 - 490
SCPLPPPVTDVSLELQQLREERNRLDAELQLSARLIQQEVGRAREQGEAERQQLSKVAQQLEQELQQTQE    491 - 560
SLASLGLQLEVARQGQQESTEEAASLRQELTQQQELYGQALQEKVAEVETRLREQLSDTERRLNEARREH    561 - 630
AKAVVSLRQIQRRAAQEKERSQELRRLQEEARKEEGQRLARRLQELERDKNLMLATLQQEGLLSRYKQQR    631 - 700
LLTVLPSLLDKKKSVVSSPRPPECSASAPVAAAVPTRESIKGSLSVLLDDLQDLSEAISKEEAVCQGDNL    701 - 770
DRCSSSNPQMSS                                                              771 - 782
//

Text Mined References (42)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24858563 2014 CCHCR1 interacts with EDC4, suggesting its localization in P-bodies.
24664238 2014 CCHCR1 interacts specifically with the E2 protein of human papillomavirus type 16 on a surface overlapping BRD4 binding.
23955597 2013 Common variation at 3q26.2, 6p21.33, 17p11.2 and 22q13.1 influences multiple myeloma risk.
23644468 2013 CEP162 is an axoneme-recognition protein promoting ciliary transition zone assembly at the cilia base.
23263863 2013 GWAS of blood cell traits identifies novel associated loci and epistatic interactions in Caucasian and African-American children.
23189171 2012 Centrosomal localization of the psoriasis candidate gene product, CCHCR1, supports a role in cytoskeletal organization.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
22182809 2011 Psoriasis-associated genetic polymorphism in North Indian population in the CCHCR1 gene and in a genomic segment flanking the HLA-C region.
21912425 2013 A whole-genome association study of major determinants for allopurinol-related Stevens-Johnson syndrome and toxic epidermal necrolysis in Japanese patients.
More...