Property Summary

NCBI Gene PubMed Count 40
PubMed Score 9.58
PubTator Score 104.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -1.100 0.002
osteosarcoma -1.682 0.000
ovarian cancer 1.100 0.000

Synonym

Gene

  Ortholog (7)

Species Source
Mouse OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (19)

PMID Text
24858563 Confocal imaging confirmed the localization of CCHCR1 in P-bodies.
24664238 CCHCR1 interacts specifically with the E2 protein of human papillomavirus type 16 on a surface overlapping BRD4 binding
23189171 The centrosomal localization of CCHCR1 provides a connection to the abnormal cell proliferation and offers a link to possible cellular pathways altered in psoriasis.
22182809 Psoriasis is associated with genetic polymorphism in the CCHCR1 gene and in a genomic segment flanking the HLA-C region in the North Indian population.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19551138 CCHCR1 is up-regulated in skin cancer and associated with EGFR expression
19242354 Observational study of gene-disease association. (HuGE Navigator)
18174193 the aberrant function of CCHCR1 may lead to abnormal keratinocyte proliferation which is a key feature of psoriatic epidermis.
17530646 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MFPPSGSTGLIPPSHFQARPLSTLPRMAPTWLSDIPLVQPPGHQDVSERRLDTQRPQVTMWERDVSSDRQ      1 - 70
EPGRRGRSWGLEGSQALSQQAEVIVRQLQELRRLEEEVRLLRETSLQQKMRLEAQAMELEALARAEKAGR     71 - 140
AEAEGLRAALAGAEVVRKNLEEGSQRELEEVQRLHQEQLSSLTQAHEEALSSLTSKAEGLEKSLSSLETR    141 - 210
RAGEAKELAEAQREAELLRKQLSKTQEDLEAQVTLVENLRKYVGEQVPSEVHSQTWELERQKLLETMQHL    211 - 280
QEDRDSLHATAELLQVRVQSLTHILALQEEELTRKVQPSDSLEPEFTRKCQSLLNRWREKVFALMVQLKA    281 - 350
QELEHSDSVKQLKGQVASLQEKVTSQSQEQAILQRSLQDKAAEVEVERMGAKGLQLELSRAQEARRRWQQ    351 - 420
QTASAEEQLRLVVNAVSSSQIWLETTMAKVEGAAAQLPSLNNRLSYAVRKVHTIRGLIARKLALAQLRQE    421 - 490
SCPLPPPVTDVSLELQQLREERNRLDAELQLSARLIQQEVGRAREQGEAERQQLSKVAQQLEQELQQTQE    491 - 560
SLASLGLQLEVARQGQQESTEEAASLRQELTQQQELYGQALQEKVAEVETRLREQLSDTERRLNEARREH    561 - 630
AKAVVSLRQIQRRAAQEKERSQELRRLQEEARKEEGQRLARRLQELERDKNLMLATLQQEGLLSRYKQQR    631 - 700
LLTVLPSLLDKKKSVVSSPRPPECSASAPVAAAVPTRESIKGSLSVLLDDLQDLSEAISKEEAVCQGDNL    701 - 770
DRCSSSNPQMSS                                                              771 - 782
//

Text Mined References (42)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24858563 2014 CCHCR1 interacts with EDC4, suggesting its localization in P-bodies.
24664238 2014 CCHCR1 interacts specifically with the E2 protein of human papillomavirus type 16 on a surface overlapping BRD4 binding.
23955597 2013 Common variation at 3q26.2, 6p21.33, 17p11.2 and 22q13.1 influences multiple myeloma risk.
23644468 2013 CEP162 is an axoneme-recognition protein promoting ciliary transition zone assembly at the cilia base.
23263863 2013 GWAS of blood cell traits identifies novel associated loci and epistatic interactions in Caucasian and African-American children.
23189171 2012 Centrosomal localization of the psoriasis candidate gene product, CCHCR1, supports a role in cytoskeletal organization.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
22182809 2011 Psoriasis-associated genetic polymorphism in North Indian population in the CCHCR1 gene and in a genomic segment flanking the HLA-C region.
21912425 2013 A whole-genome association study of major determinants for allopurinol-related Stevens-Johnson syndrome and toxic epidermal necrolysis in Japanese patients.
More...