Property Summary

NCBI Gene PubMed Count 13
PubMed Score 188.14
PubTator Score 64.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute quadriplegic myopathy -1.631 6.6e-06
Breast cancer 1.100 4.8e-04
chronic lymphosyte leukemia 1.400 1.3e-07
group 3 medulloblastoma -1.300 1.3e-02
intraductal papillary-mucinous adenoma (... -1.500 1.8e-02
intraductal papillary-mucinous carcinoma... -1.200 3.8e-02
lung adenocarcinoma 2.000 1.0e-09
lung carcinoma 1.500 4.7e-15
non-small cell lung cancer 2.306 4.9e-20
ovarian cancer 1.800 3.9e-07
Polycystic ovary syndrome -1.489 2.8e-03
psoriasis 1.400 2.6e-27

Protein-protein Interaction (3)

Gene RIF (8)

AA Sequence

MQRAAALVRRGCGPRTPSSWGRSQSSAAAEASAVLKVRPERSRRERILTLESMNPQVKAVEYAVRGPIVL      1 - 70
KAGEIELELQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPNLLDSPSFPEDAKKRARRILQ     71 - 140
ACGGNSLGSYSASQGVNCIREDVAAYITRRDGGVPADPDNIYLTTGASDGISTILKILVSGGGKSRTGVM    141 - 210
IPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRK    211 - 280
CIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYR    281 - 350
GGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLT    351 - 420
EDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVPGSGFGQREGT    421 - 490
YHFRMTILPPVEKLKTVLQKVKDFHINFLEKYA                                         491 - 523
//

Text Mined References (14)

PMID Year Title