Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.19
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.100 2.3e-03
atypical teratoid / rhabdoid tumor -2.300 5.1e-08
ependymoma 1.100 4.6e-03
glioblastoma -1.100 2.9e-03
group 3 medulloblastoma -1.700 1.0e-05
lung carcinoma 1.400 7.8e-35
medulloblastoma, large-cell -3.000 6.6e-08
oligodendroglioma 1.200 3.8e-03
primitive neuroectodermal tumor -1.800 1.8e-05

Gene RIF (1)

AA Sequence

MADTATTASAAAASAASASSDAPPFQLGKPRFQQTSFYGRFRHFLDIIDPRTLFVTERRLREAVQLLEDY      1 - 70
KHGTLRPGVTNEQLWSAQKIKQAILHPDTNEKIFMPFRMSGYIPFGTPIVVGLLLPNQTLASTVFWQWLN     71 - 140
QSHNACVNYANRNATKPSPASKFIQGYLGAVISAVSIAVGLNVLVQKANKFTPATRLLIQRFVPFPAVAS    141 - 210
ANICNVVLMRYGELEEGIDVLDSDGNLVGSSKIAARHALLETALTRVVLPMPILVLPPIVMSMLEKTALL    211 - 280
QARPRLLLPVQSLVCLAAFGLALPLAISLFPQMSEIETSQLEPEIAQATSSRTVVYNKGL              281 - 340
//

Text Mined References (8)

PMID Year Title