Property Summary

NCBI Gene PubMed Count 18
Grant Count 30
R01 Count 23
Funding $1,861,266.44
PubMed Score 45.65
PubTator Score 19.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.400 0.009
ependymoma -1.500 0.010
oligodendroglioma -1.700 0.004
osteosarcoma -1.585 0.031
glioblastoma -1.300 0.000
group 3 medulloblastoma -1.600 0.000
cystic fibrosis -1.545 0.000
medulloblastoma, large-cell -1.700 0.000
primitive neuroectodermal tumor -1.200 0.014
lung adenocarcinoma -1.500 0.000
pediatric high grade glioma -1.100 0.000
lung carcinoma -1.300 0.000
Breast cancer -1.700 0.000
gastric carcinoma -3.200 0.017

Gene RIF (13)

PMID Text
25855082 GLUT12 is a versatile transporter: it transports a wide diversity of hexoses, it can work as a Na+ or H+/glucose symporter, and it shows electrogenic properties.
24820014 findings show the level of expression of GLUT12 was significantly higher in Alzheimer's disease compare to aged controls
23396969 Intestinal dehydroascorbic acid (DHA) transport is mediated by the facilitative sugar transporters, GLUT2 and GLUT8
23302780 study provides the first direct evidence for GLUT9 and GLUT12 expression in vascular smooth muscle cells in conjunction with the previously identified GLUT1 and GLUT10
20965718 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
19549745 Translocation of GLUT12 in cultured myoblasts was dependent on activation of PI3-K.
18978678 Observational study of gene-disease association. (HuGE Navigator)
16803853 GLUT4 and GLUT12 were predominantly expressed in type I oxidative fibers; however, GLUT5 was expressed predominantly in type II (white) fibers
16091581 GLUT12 protein was localized to the apical membrane of human and rat distal tubules and collecting ducts. Levels of both GLUT1 and GLUT12 are elevated in animal models of hypertension and diabetic nephropathy.
More...

AA Sequence

MVPVENTEGPSLLNQKGTAVETEGSGSRHPPWARGCGMFTFLSSVTAAVSGLLVGYELGIISGALLQIKT      1 - 70
LLALSCHEQEMVVSSLVIGALLASLTGGVLIDRYGRRTAIILSSCLLGLGSLVLILSLSYTVLIVGRIAI     71 - 140
GVSISLSSIATCVYIAEIAPQHRRGLLVSLNELMIVIGILSAYISNYAFANVFHGWKYMFGLVIPLGVLQ    141 - 210
AIAMYFLPPSPRFLVMKGQEGAASKVLGRLRALSDTTEELTVIKSSLKDEYQYSFWDLFRSKDNMRTRIM    211 - 280
IGLTLVFFVQITGQPNILFYASTVLKSVGFQSNEAASLASTGVGVVKVISTIPATLLVDHVGSKTFLCIG    281 - 350
SSVMAASLVTMGIVNLNIHMNFTHICRSHNSINQSLDESVIYGPGNLSTNNNTLRDHFKGISSHSRSSLM    351 - 420
PLRNDVDKRGETTSASLLNAGLSHTEYQIVTDPGDVPAFLKWLSLASLLVYVAAFSIGLGPMPWLVLSEI    421 - 490
FPGGIRGRAMALTSSMNWGINLLISLTFLTVTDLIGLPWVCFIYTIMSLASLLFVVMFIPETKGCSLEQI    491 - 560
SMELAKVNYVKNNICFMSHHQEELVPKQPQKRKPQEQLLECNKLCGRGQSRQLSPET                 561 - 617
//

Text Mined References (20)

PMID Year Title
25855082 2015 Functional characterization of the human facilitative glucose transporter 12 (GLUT12) by electrophysiological methods.
24820014 2014 Expression of the glucose transporter GLUT12 in Alzheimer's disease patients.
23396969 2013 Intestinal dehydroascorbic acid (DHA) transport mediated by the facilitative sugar transporters, GLUT2 and GLUT8.
23302780 2013 Expression of conventional and novel glucose transporters, GLUT1, -9, -10, and -12, in vascular smooth muscle cells.
20965718 2011 Genetic variability of the fatty acid synthase pathway is not associated with prostate cancer risk in the European Prospective Investigation on Cancer (EPIC).
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
19549745 2009 Insulin-stimulated translocation of glucose transporter (GLUT) 12 parallels that of GLUT4 in normal muscle.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
16803853 2006 Hexose transporter mRNAs for GLUT4, GLUT5, and GLUT12 predominate in human muscle.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...