Property Summary

NCBI Gene PubMed Count 19
PubMed Score 48.99
PubTator Score 19.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.100 6.5e-04
astrocytic glioma -1.400 9.1e-03
Breast cancer -1.700 1.1e-09
cystic fibrosis -1.038 4.6e-03
ependymoma -1.500 1.0e-02
gastric carcinoma -1.600 8.1e-03
glioblastoma -1.200 6.5e-07
group 3 medulloblastoma -1.200 2.1e-04
lung adenocarcinoma -1.500 1.3e-14
lung carcinoma -1.300 8.1e-10
medulloblastoma, large-cell -1.100 1.5e-04
oligodendroglioma -1.700 4.5e-03
osteosarcoma -1.585 3.1e-02
primitive neuroectodermal tumor -1.200 1.4e-02

 GWAS Trait (1)

Gene RIF (14)

AA Sequence

MVPVENTEGPSLLNQKGTAVETEGSGSRHPPWARGCGMFTFLSSVTAAVSGLLVGYELGIISGALLQIKT      1 - 70
LLALSCHEQEMVVSSLVIGALLASLTGGVLIDRYGRRTAIILSSCLLGLGSLVLILSLSYTVLIVGRIAI     71 - 140
GVSISLSSIATCVYIAEIAPQHRRGLLVSLNELMIVIGILSAYISNYAFANVFHGWKYMFGLVIPLGVLQ    141 - 210
AIAMYFLPPSPRFLVMKGQEGAASKVLGRLRALSDTTEELTVIKSSLKDEYQYSFWDLFRSKDNMRTRIM    211 - 280
IGLTLVFFVQITGQPNILFYASTVLKSVGFQSNEAASLASTGVGVVKVISTIPATLLVDHVGSKTFLCIG    281 - 350
SSVMAASLVTMGIVNLNIHMNFTHICRSHNSINQSLDESVIYGPGNLSTNNNTLRDHFKGISSHSRSSLM    351 - 420
PLRNDVDKRGETTSASLLNAGLSHTEYQIVTDPGDVPAFLKWLSLASLLVYVAAFSIGLGPMPWLVLSEI    421 - 490
FPGGIRGRAMALTSSMNWGINLLISLTFLTVTDLIGLPWVCFIYTIMSLASLLFVVMFIPETKGCSLEQI    491 - 560
SMELAKVNYVKNNICFMSHHQEELVPKQPQKRKPQEQLLECNKLCGRGQSRQLSPET                 561 - 617
//

Text Mined References (21)

PMID Year Title