Property Summary

NCBI Gene PubMed Count 32
Grant Count 3
Funding $1,272,904
PubMed Score 27.63
PubTator Score 18.48

Knowledge Summary

Patent (5,162)

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
osteosarcoma 1.340 0.000
astrocytoma 1.400 0.003
medulloblastoma, large-cell 1.200 0.000
lung cancer -1.500 0.001
ovarian cancer -2.000 0.000
Breast cancer -1.100 0.000
Gaucher disease type 1 -1.100 0.020
dermatomyositis -1.100 0.000

Synonym

Accession Q8TD19 Q52LK6 Q8NCN0 Q8TCY4 Q9UPI4 Q9Y6S4 Q9Y6S5 Q9Y6S6
Symbols NC
APUG
NERCC
LCCS10
NERCC1

Gene

PANTHER Protein Class (3)

PDB

3ZKE   3ZKF  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (16)

PMID Text
26676776 Overall, these results highlight the complexity of virus-host interactions and identify a new role for the cellular protein Nek9 during human adenovirus infection, suggesting a role for Nek9 in regulating p53 target gene expression.
26522158 The C-terminal domain of Nek9 activates Nek7 through promoting back-to-back dimerization.
25131192 The findings demonstrate that a novel NEK9 network regulates the growth of cancer cells lacking functional p53.
23665325 NEK9 inhibition represents a novel anti-cancer strategy by induction of mitotic catastrophe via impairment of spindle dynamics, cytokinesis and mitotic checkpoint control.
23482567 Structural analysis of LC8 with both Nek9 peptides, together with different biophysical experiments, explains the observed diminished binding affinity of Nek9 to LC8 upon phosphorylation on Ser(944) within the Nek9 sequence
22818914 Nek9 phosphorylates NEDD1 on Ser377 driving its recruitment and thereby that of gamma-tubulin to the centrosome in mitotic cells.
21735226 The interaction between the human NimA-like protein kinase Nek9 and the Helicobacter HcpC has been validated by ELISA and surface plasmon resonance.
21642957 Nek9 is a Plk1-activated kinase that controls early centrosome separation through Nek6/7 and Eg5.
21454704 DYNLL/LC8 protein controls signal transduction through the Nek9/Nek6 signaling module by regulating Nek6 binding to Nek9.
20508983 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSVLGEYERHCDSINSDFGSESGGCGDSSPGPSASQGPRAGGGAAEQEELHYIPIRVLGRGAFGEATLYR      1 - 70
RTEDDSLVVWKEVDLTRLSEKERRDALNEIVILALLQHDNIIAYYNHFMDNTTLLIELEYCNGGNLYDKI     71 - 140
LRQKDKLFEEEMVVWYLFQIVSAVSCIHKAGILHRDIKTLNIFLTKANLIKLGDYGLAKKLNSEYSMAET    141 - 210
LVGTPYYMSPELCQGVKYNFKSDIWAVGCVIFELLTLKRTFDATNPLNLCVKIVQGIRAMEVDSSQYSLE    211 - 280
LIQMVHSCLDQDPEQRPTADELLDRPLLRKRRREMEEKVTLLNAPTKRPRSSTVTEAPIAVVTSRTSEVY    281 - 350
VWGGGKSTPQKLDVIKSGCSARQVCAGNTHFAVVTVEKELYTWVNMQGGTKLHGQLGHGDKASYRQPKHV    351 - 420
EKLQGKAIRQVSCGDDFTVCVTDEGQLYAFGSDYYGCMGVDKVAGPEVLEPMQLNFFLSNPVEQVSCGDN    421 - 490
HVVVLTRNKEVYSWGCGEYGRLGLDSEEDYYTPQKVDVPKALIIVAVQCGCDGTFLLTQSGKVLACGLNE    491 - 560
FNKLGLNQCMSGIINHEAYHEVPYTTSFTLAKQLSFYKIRTIAPGKTHTAAIDERGRLLTFGCNKCGQLG    561 - 630
VGNYKKRLGINLLGGPLGGKQVIRVSCGDEFTIAATDDNHIFAWGNGGNGRLAMTPTERPHGSDICTSWP    631 - 700
RPIFGSLHHVPDLSCRGWHTILIVEKVLNSKTIRSNSSGLSIGTVFQSSSPGGGGGGGGGEEEDSQQESE    701 - 770
TPDPSGGFRGTMEADRGMEGLISPTEAMGNSNGASSSCPGWLRKELENAEFIPMPDSPSPLSAAFSESEK    771 - 840
DTLPYEELQGLKVASEAPLEHKPQVEASSPRLNPAVTCAGKGTPLTPPACACSSLQVEVERLQGLVLKCL    841 - 910
AEQQKLQQENLQIFTQLQKLNKKLEGGQQVGMHSKGTQTAKEEMEMDPKPDLDSDSWCLLGTDSCRPSL     911 - 979
//

Text Mined References (43)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26676776 2015 The Dual Nature of Nek9 in Adenovirus Replication.
26522158 2015 Mechanistic basis of Nek7 activation through Nek9 binding and induced dimerization.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25131192 2014 NEK9-dependent proliferation of cancer cells lacking functional p53.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23665325 2013 NEK9 depletion induces catastrophic mitosis by impairment of mitotic checkpoint control and spindle dynamics.
23482567 2013 Structural analysis of the regulation of the DYNLL/LC8 binding to Nek9 by phosphorylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...