Property Summary

Ligand Count 1
NCBI Gene PubMed Count 37
PubMed Score 27.94
PubTator Score 18.48

Knowledge Summary

Patent (5,162)

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.400 2.7e-03
Breast cancer -1.100 1.9e-07
dermatomyositis -1.100 2.0e-04
Gaucher disease type 1 -1.100 2.0e-02
lung cancer -1.500 5.9e-04
malignant mesothelioma -1.100 3.3e-05
medulloblastoma, large-cell 1.200 5.5e-05
osteosarcoma 1.340 2.4e-05
ovarian cancer -2.000 6.8e-09

 GWAS Trait (1)

Gene RIF (20)

AA Sequence

MSVLGEYERHCDSINSDFGSESGGCGDSSPGPSASQGPRAGGGAAEQEELHYIPIRVLGRGAFGEATLYR      1 - 70
RTEDDSLVVWKEVDLTRLSEKERRDALNEIVILALLQHDNIIAYYNHFMDNTTLLIELEYCNGGNLYDKI     71 - 140
LRQKDKLFEEEMVVWYLFQIVSAVSCIHKAGILHRDIKTLNIFLTKANLIKLGDYGLAKKLNSEYSMAET    141 - 210
LVGTPYYMSPELCQGVKYNFKSDIWAVGCVIFELLTLKRTFDATNPLNLCVKIVQGIRAMEVDSSQYSLE    211 - 280
LIQMVHSCLDQDPEQRPTADELLDRPLLRKRRREMEEKVTLLNAPTKRPRSSTVTEAPIAVVTSRTSEVY    281 - 350
VWGGGKSTPQKLDVIKSGCSARQVCAGNTHFAVVTVEKELYTWVNMQGGTKLHGQLGHGDKASYRQPKHV    351 - 420
EKLQGKAIRQVSCGDDFTVCVTDEGQLYAFGSDYYGCMGVDKVAGPEVLEPMQLNFFLSNPVEQVSCGDN    421 - 490
HVVVLTRNKEVYSWGCGEYGRLGLDSEEDYYTPQKVDVPKALIIVAVQCGCDGTFLLTQSGKVLACGLNE    491 - 560
FNKLGLNQCMSGIINHEAYHEVPYTTSFTLAKQLSFYKIRTIAPGKTHTAAIDERGRLLTFGCNKCGQLG    561 - 630
VGNYKKRLGINLLGGPLGGKQVIRVSCGDEFTIAATDDNHIFAWGNGGNGRLAMTPTERPHGSDICTSWP    631 - 700
RPIFGSLHHVPDLSCRGWHTILIVEKVLNSKTIRSNSSGLSIGTVFQSSSPGGGGGGGGGEEEDSQQESE    701 - 770
TPDPSGGFRGTMEADRGMEGLISPTEAMGNSNGASSSCPGWLRKELENAEFIPMPDSPSPLSAAFSESEK    771 - 840
DTLPYEELQGLKVASEAPLEHKPQVEASSPRLNPAVTCAGKGTPLTPPACACSSLQVEVERLQGLVLKCL    841 - 910
AEQQKLQQENLQIFTQLQKLNKKLEGGQQVGMHSKGTQTAKEEMEMDPKPDLDSDSWCLLGTDSCRPSL     911 - 979
//

Text Mined References (49)

PMID Year Title