Property Summary

NCBI Gene PubMed Count 8
PubMed Score 44.07
PubTator Score 24.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.400 1.1e-03
atypical teratoid / rhabdoid tumor 1.300 1.7e-05
glioblastoma 1.300 3.5e-04
group 3 medulloblastoma 1.500 5.2e-03
medulloblastoma, large-cell 1.600 3.1e-05
osteosarcoma 1.194 5.1e-06
ovarian cancer -2.100 6.6e-10
progressive supranuclear palsy 1.100 9.8e-03
spina bifida -1.236 4.9e-02
subependymal giant cell astrocytoma -1.651 2.6e-03

Protein-protein Interaction (6)

AA Sequence

MAEAAPAPTSEWDSECLTSLQPLPLPTPPAANEAHLQTAAISLWTVVAAVQAIERKVEIHSRRLLHLEGR      1 - 70
TGTAEKKLASCEKTVTELGNQLEGKWAVLGTLLQEYGLLQRRLENLENLLRNRNFWILRLPPGIKGDIPK     71 - 140
VPVAFDDVSIYFSTPEWEKLEEWQKELYKNIMKGNYESLISMDYAINQPDVLSQIQPEGEHNTEDQAGPE    141 - 210
ESEIPTDPSEEPGISTSDILSWIKQEEEPQVGAPPESKESDVYKSTYADEELVIKAEGLARSSLCPEVPV    211 - 280
PFSSPPAAAKDAFSDVAFKSQQSTSMTPFGRPATDLPEASEGQVTFTQLGSYPLPPPVGEQVFSCHHCGK    281 - 350
NLSQDMLLTHQCSHATEHPLPCAQCPKHFTPQADLSSTSQDHASETPPTCPHCARTFTHPSRLTYHLRVH    351 - 420
NSTERPFPCPDCPKRFADQARLTSHRRAHASERPFRCAQCGRSFSLKISLLLHQRGHAQERPFSCPQCGI    421 - 490
DFNGHSALIRHQMIHTGERPYPCTDCSKSFMRKEHLLNHRRLHTGERPFSCPHCGKSFIRKHHLMKHQRI    491 - 560
HTGERPYPCSYCGRSFRYKQTLKDHLRSGHNGGCGGDSDPSGQPPNPPGPLITGLETSGLGVNTEGLETN    561 - 630
QWYGEGSGGGVL                                                              631 - 642
//

Text Mined References (10)

PMID Year Title