Property Summary

NCBI Gene PubMed Count 8
Grant Count 63
R01 Count 29
Funding $9,508,669.66
PubMed Score 41.69
PubTator Score 24.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.364 0.000
atypical teratoid / rhabdoid tumor -1.700 0.001
glioblastoma -1.700 0.000
group 3 medulloblastoma 1.500 0.005
medulloblastoma, large-cell -1.900 0.000
adult high grade glioma -1.400 0.001
subependymal giant cell astrocytoma -1.651 0.003
spina bifida -1.236 0.049
progressive supranuclear palsy 1.100 0.010
ovarian cancer -2.100 0.000

Synonym

Accession Q8TD17 A8K384 B4E377 Q8TD18 Q9P2K7 Q9UDV8
Symbols P51
P71
ZER6

Gene

AA Sequence

MAEAAPAPTSEWDSECLTSLQPLPLPTPPAANEAHLQTAAISLWTVVAAVQAIERKVEIHSRRLLHLEGR      1 - 70
TGTAEKKLASCEKTVTELGNQLEGKWAVLGTLLQEYGLLQRRLENLENLLRNRNFWILRLPPGIKGDIPK     71 - 140
VPVAFDDVSIYFSTPEWEKLEEWQKELYKNIMKGNYESLISMDYAINQPDVLSQIQPEGEHNTEDQAGPE    141 - 210
ESEIPTDPSEEPGISTSDILSWIKQEEEPQVGAPPESKESDVYKSTYADEELVIKAEGLARSSLCPEVPV    211 - 280
PFSSPPAAAKDAFSDVAFKSQQSTSMTPFGRPATDLPEASEGQVTFTQLGSYPLPPPVGEQVFSCHHCGK    281 - 350
NLSQDMLLTHQCSHATEHPLPCAQCPKHFTPQADLSSTSQDHASETPPTCPHCARTFTHPSRLTYHLRVH    351 - 420
NSTERPFPCPDCPKRFADQARLTSHRRAHASERPFRCAQCGRSFSLKISLLLHQRGHAQERPFSCPQCGI    421 - 490
DFNGHSALIRHQMIHTGERPYPCTDCSKSFMRKEHLLNHRRLHTGERPFSCPHCGKSFIRKHHLMKHQRI    491 - 560
HTGERPYPCSYCGRSFRYKQTLKDHLRSGHNGGCGGDSDPSGQPPNPPGPLITGLETSGLGVNTEGLETN    561 - 630
QWYGEGSGGGVL                                                              631 - 642
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21516116 2011 Next-generation sequencing to generate interactome datasets.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11779858 2002 A novel zinc finger transcription factor with two isoforms that are differentially repressed by estrogen receptor-alpha.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.