Property Summary

NCBI Gene PubMed Count 27
Grant Count 1
Funding $29,340
PubMed Score 23.91
PubTator Score 20.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
esophageal adenocarcinoma -1.900 0.018
osteosarcoma 2.662 0.000
astrocytoma 1.100 0.006
medulloblastoma, large-cell -1.100 0.000
spina bifida -1.174 0.024
ovarian cancer 2.200 0.000
dermatomyositis 1.100 0.000

Synonym

Accession Q8TD16 O75181 Q5TBQ2 Q5TBQ3 Q96LH2 Q9BT84 Q9H561 Bic-D 2
Symbols SMALED2
bA526D8.1

Gene

 Grant Application (1)

 GO Function (1)

Gene RIF (10)

PMID Text
25962623 several analyses of vesicular transport demonstrated that Rab6A and BICD2 play crucial roles in Golgi tubule fusion with the endoplasmic reticulum (ER) in brefeldin A (BFA)-treated cells
25497877 the features of BICD2 spinal muscular atrophy, lower extremity predominant are consistent with a pathological process that preferentially affects lumbar lower motor neurons
24507884 This study identified BICD3 significantly associated loci with a biologically plausible role in schizophrenia.
23664120 Disease causing mutations resulting in amino acid substitutions in two binding regions of BICD2 increase its binding affinity for the cytoplasmic dynein-dynactin complex.
23664119 BICD2 mutations cause non-5q linked spinal muscular atrophy in humans
23664116 Mutations in BICD2 cause congenital autosomal-dominant spinal muscular atrophy and massive Golgi fragmentation in affected cells.
23097494 Data suggest that ASUN promotes perinuclear enrichment of dynein at G2/M that facilitates BICD2- and CENP-F-mediated anchoring of dynein to nuclear pore complexes.
22190034 HIV-1 PR is identified to have a physical interaction with bicaudal D homolog 2 (BICD2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
18976975 Knockdown of bicaudal D homolog 2 (BICD2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
11864968 isolation, cloning, and characterization of human Nek8, a new mammalian NIMA-related kinase, and its candidate substrate Bicd2

AA Sequence

MSAPSEEEEYARLVMEAQPEWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQFEELEVDYEA      1 - 70
IRSEMEQLKEAFGQAHTNHKKVAADGESREESLIQESASKEQYYVRKVLELQTELKQLRNVLTNTQSENE     71 - 140
RLASVAQELKEINQNVEIQRGRLRDDIKEYKFREARLLQDYSELEEENISLQKQVSVLRQNQVEFEGLKH    141 - 210
EIKRLEEETEYLNSQLEDAIRLKEISERQLEEALETLKTEREQKNSLRKELSHYMSINDSFYTSHLHVSL    211 - 280
DGLKFSDDAAEPNNDAEALVNGFEHGGLAKLPLDNKTSTPKKEGLAPPSPSLVSDLLSELNISEIQKLKQ    281 - 350
QLMQMEREKAGLLATLQDTQKQLEHTRGSLSEQQEKVTRLTENLSALRRLQASKERQTALDNEKDRDSHE    351 - 420
DGDYYEVDINGPEILACKYHVAVAEAGELREQLKALRSTHEAREAQHAEEKGRYEAEGQALTEKVSLLEK    421 - 490
ASRQDRELLARLEKELKKVSDVAGETQGSLSVAQDELVTFSEELANLYHHVCMCNNETPNRVMLDYYREG    491 - 560
QGGAGRTSPGGRTSPEARGRRSPILLPKGLLAPEAGRADGGTGDSSPSPGSSLPSPLSDPRREPMNIYNL    561 - 630
IAIIRDQIKHLQAAVDRTTELSRQRIASQELGPAVDKDKEALMEEILKLKSLLSTKREQITTLRTVLKAN    631 - 700
KQTAEVALANLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYITQLDEMQRQLAA    701 - 770
AEDEKKTLNSLLRMAIQQKLALTQRLELLELDHEQTRRGRAKAAPKTKPATPSL                    771 - 824
//

Text Mined References (38)

PMID Year Title
25962623 2015 Reconstitution of the targeting of Rab6A to the Golgi apparatus in semi-intact HeLa cells: A role of BICD2 in stabilizing Rab6A on Golgi membranes and a concerted role of Rab6A/BICD2 interactions in Golgi-to-ER retrograde transport.
25512093 2015 Novel mutations in the DYNC1H1 tail domain refine the genetic and clinical spectrum of dyneinopathies.
25497877 2015 Phenotypic and molecular insights into spinal muscular atrophy due to mutations in BICD2.
24507884 2014 Combined analysis of exon splicing and genome wide polymorphism data predict schizophrenia risk loci.
24482476 2014 Exome sequencing links corticospinal motor neuron disease to common neurodegenerative disorders.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23664120 2013 Mutations in BICD2 cause dominant congenital spinal muscular atrophy and hereditary spastic paraplegia.
23664119 2013 Molecular defects in the motor adaptor BICD2 cause proximal spinal muscular atrophy with autosomal-dominant inheritance.
23664116 2013 Mutations in BICD2, which encodes a golgin and important motor adaptor, cause congenital autosomal-dominant spinal muscular atrophy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...