Property Summary

NCBI Gene PubMed Count 12
PubMed Score 11.80
PubTator Score 3.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

Gene RIF (4)

AA Sequence

MENWSKDITHSYLEQETTGINKSTQPDEQLTMNSEKSMHRKSTELVNEITCENTEWPGQRSTNFQIISSY      1 - 70
PDDESVYCTTEKYNVMEHRHNDMHYECMTPCQVTSDSDKEKTIAFLLKELDILRTSNKKLQQKLAKEDKE     71 - 140
QRKLKFKLELQEKETEAKIAEKTAALVEEVYFAQKERDEAVMSRLQLAIEERDEAIARAKHMEMSLKVLE    141 - 210
NINPEENDMTLQELLNRINNADTGIAIQKNGAIIVDRIYKTKECKMRITAEEMSALIEERDAALSKCKRL    211 - 280
EQELHHVKEQNQTSANNMRHLTAENNQERALKAKLLSMQQARETAVQQYKKLEEEIQTLRVYYSLHKSLS    281 - 350
QEENLKDQFNYTLSTYEEALKNRENIVSITQQQNEELATQLQQALTERANMELQLQHAREASQVANEKVQ    351 - 420
KLERLVDVLRKKVGTGTMRTVI                                                    421 - 442
//

Text Mined References (13)

PMID Year Title