Property Summary

NCBI Gene PubMed Count 21
Grant Count 12
R01 Count 8
Funding $897,560.93
PubMed Score 29.56
PubTator Score 18.36

Knowledge Summary

Patent (3,796)

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.700 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (14)

PMID Text
26291129 depletion of endogenous MAPK15 expression inhibited BCR-ABL1-dependent cell proliferation, in vitro
26035356 The present study suggests that MAPK15 overexpression may contribute to the malignant transformation of gastric mucosa by prolonging the stability of c-Jun.
24618899 ERK8 appears as a constitutive brake on N-Acetylgalactosaminyltransferase relocalisation, and the loss of its expression could drive cancer aggressivity through increased cell motility.
23326322 Data suggest that the model coulb be a tool for the development of specific ERK8 kinase inhibitors.
22948227 ATG8-like proteins (MAP1LC3B, GABARAP and GABARAPL1) are novel interactors of MAPK15/ERK8, a MAP kinase involved in cell proliferation and transformation.
21190936 a novel function for ERK8 as a bona fide ERRalpha corepressor, involved in control of its cellular localization by nuclear exclusion, and suggest a key role for this MAP kinase in the regulation of the biological activities of this nuclear receptor.
20733054 Data show that ERK8 prevents HDM2-mediated PCNA destruction by inhibiting the association of PCNA with HDM2, and implicate ERK8 in the regulation of genomic stability.
20395206 Extracellular signal-regulated kinase 8-mediated c-Jun phosphorylation increases tumorigenesis of human colon cancer
19166846 Regulation of the activity and expression of DERK8 by DNA damage are reported.
16624805 human ERK8 has a role as a negative regulator of human GRalpha, acting through Hic-5
More...

AA Sequence

MCTVVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFREITLLQEFGDH      1 - 70
PNIISLLDVIRAENDRDIYLVFEFMDTDLNAVIRKGGLLQDVHVRSIFYQLLRATRFLHSGHVVHRDQKP     71 - 140
SNVLLDANCTVKLCDFGLARSLGDLPEGPEDQAVTEYVATRWYRAPEVLLSSHRYTLGVDMWSLGCILGE    141 - 210
MLRGRPLFPGTSTLHQLELILETIPPPSEEDLLALGSGCRASVLHQLGSRPRQTLDALLPPDTSPEALDL    211 - 280
LRRLLVFAPDKRLSATQALQHPYVQRFHCPSDEWAREADVRPRAHEGVQLSVPEYRSRVYQMILECGGSS    281 - 350
GTSREKGPEGVSPSQAHLHKPRADPQLPSRTPVQGPRPRPQSSPGHDPAEHESPRAAKNVPRQNSAPLLQ    351 - 420
TALLGNGERPPGAKEAPPLTLSLVKPSGRGAAPSLTSQAAAQVANQALIRGDWNRGGGVRVASVQQVPPR    421 - 490
LPPEARPGRRMFSTSALQGAQGGARALLGGYSQAYGTVCHSALGHLPLLEGHHV                    491 - 544
//

Text Mined References (23)

PMID Year Title
26291129 2015 MAPK15 mediates BCR-ABL1-induced autophagy and regulates oncogene-dependent cell proliferation and tumor formation.
26035356 2015 Overexpression of MAPK15 in gastric cancer is associated with copy number gain and contributes to the stability of c-Jun.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
24618899 2014 ERK8 is a negative regulator of O-GalNAc glycosylation and cell migration.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23326322 2013 Structure prediction and validation of the ERK8 kinase domain.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22948227 2012 MAPK15/ERK8 stimulates autophagy by interacting with LC3 and GABARAP proteins.
21531765 2011 High-throughput RNAi screening reveals novel regulators of telomerase.
More...