Property Summary

Ligand Count 2
NCBI Gene PubMed Count 23
PubMed Score 34.46
PubTator Score 18.36

Knowledge Summary

Patent (3,796)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Urinary Bladder Neoplasms 114 0.0 0.0
Disease Target Count
Bladder Neoplasm 112
Disease Target Count P-value
ependymoma 4679 1.5e-06
Disease Target Count Z-score Confidence
Sleeping sickness 37 4.143 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
ependymoma 1.300 1.5e-06

Gene RIF (16)

AA Sequence

MCTVVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFREITLLQEFGDH      1 - 70
PNIISLLDVIRAENDRDIYLVFEFMDTDLNAVIRKGGLLQDVHVRSIFYQLLRATRFLHSGHVVHRDQKP     71 - 140
SNVLLDANCTVKLCDFGLARSLGDLPEGPEDQAVTEYVATRWYRAPEVLLSSHRYTLGVDMWSLGCILGE    141 - 210
MLRGRPLFPGTSTLHQLELILETIPPPSEEDLLALGSGCRASVLHQLGSRPRQTLDALLPPDTSPEALDL    211 - 280
LRRLLVFAPDKRLSATQALQHPYVQRFHCPSDEWAREADVRPRAHEGVQLSVPEYRSRVYQMILECGGSS    281 - 350
GTSREKGPEGVSPSQAHLHKPRADPQLPSRTPVQGPRPRPQSSPGHDPAEHESPRAAKNVPRQNSAPLLQ    351 - 420
TALLGNGERPPGAKEAPPLTLSLVKPSGRGAAPSLTSQAAAQVANQALIRGDWNRGGGVRVASVQQVPPR    421 - 490
LPPEARPGRRMFSTSALQGAQGGARALLGGYSQAYGTVCHSALGHLPLLEGHHV                    491 - 544
//

Text Mined References (25)

PMID Year Title