Property Summary

NCBI Gene PubMed Count 21
PubMed Score 29.56
PubTator Score 18.36

Knowledge Summary

Patent (3,796)

TINX Plot

  Disease Sources (3)

Disease Target Count
Bladder Neoplasm 109
Disease Target Count P-value
posterior fossa group B ependymoma 1530 4.75676052868511E-10
Disease Target Count Z-score Confidence
Sleeping sickness 37 4.183 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.700 0.000

Synonym

Accession Q8TD08 Q2TCF9 Q8N362 MAP kinase 15
Symbols ERK7
ERK8

Gene

  Ortholog (7)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
C. elegans OMA Inparanoid

 Collection (1)

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (14)

PMID Text
26291129 depletion of endogenous MAPK15 expression inhibited BCR-ABL1-dependent cell proliferation, in vitro
26035356 The present study suggests that MAPK15 overexpression may contribute to the malignant transformation of gastric mucosa by prolonging the stability of c-Jun.
24618899 ERK8 appears as a constitutive brake on N-Acetylgalactosaminyltransferase relocalisation, and the loss of its expression could drive cancer aggressivity through increased cell motility.
23326322 Data suggest that the model coulb be a tool for the development of specific ERK8 kinase inhibitors.
22948227 ATG8-like proteins (MAP1LC3B, GABARAP and GABARAPL1) are novel interactors of MAPK15/ERK8, a MAP kinase involved in cell proliferation and transformation.
21190936 a novel function for ERK8 as a bona fide ERRalpha corepressor, involved in control of its cellular localization by nuclear exclusion, and suggest a key role for this MAP kinase in the regulation of the biological activities of this nuclear receptor.
20733054 Data show that ERK8 prevents HDM2-mediated PCNA destruction by inhibiting the association of PCNA with HDM2, and implicate ERK8 in the regulation of genomic stability.
20395206 Extracellular signal-regulated kinase 8-mediated c-Jun phosphorylation increases tumorigenesis of human colon cancer
19166846 Regulation of the activity and expression of DERK8 by DNA damage are reported.
16624805 human ERK8 has a role as a negative regulator of human GRalpha, acting through Hic-5
More...

AA Sequence

MCTVVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFREITLLQEFGDH      1 - 70
PNIISLLDVIRAENDRDIYLVFEFMDTDLNAVIRKGGLLQDVHVRSIFYQLLRATRFLHSGHVVHRDQKP     71 - 140
SNVLLDANCTVKLCDFGLARSLGDLPEGPEDQAVTEYVATRWYRAPEVLLSSHRYTLGVDMWSLGCILGE    141 - 210
MLRGRPLFPGTSTLHQLELILETIPPPSEEDLLALGSGCRASVLHQLGSRPRQTLDALLPPDTSPEALDL    211 - 280
LRRLLVFAPDKRLSATQALQHPYVQRFHCPSDEWAREADVRPRAHEGVQLSVPEYRSRVYQMILECGGSS    281 - 350
GTSREKGPEGVSPSQAHLHKPRADPQLPSRTPVQGPRPRPQSSPGHDPAEHESPRAAKNVPRQNSAPLLQ    351 - 420
TALLGNGERPPGAKEAPPLTLSLVKPSGRGAAPSLTSQAAAQVANQALIRGDWNRGGGVRVASVQQVPPR    421 - 490
LPPEARPGRRMFSTSALQGAQGGARALLGGYSQAYGTVCHSALGHLPLLEGHHV                    491 - 544
//

Text Mined References (23)

PMID Year Title
26291129 2015 MAPK15 mediates BCR-ABL1-induced autophagy and regulates oncogene-dependent cell proliferation and tumor formation.
26035356 2015 Overexpression of MAPK15 in gastric cancer is associated with copy number gain and contributes to the stability of c-Jun.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
24618899 2014 ERK8 is a negative regulator of O-GalNAc glycosylation and cell migration.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23326322 2013 Structure prediction and validation of the ERK8 kinase domain.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22948227 2012 MAPK15/ERK8 stimulates autophagy by interacting with LC3 and GABARAP proteins.
21531765 2011 High-throughput RNAi screening reveals novel regulators of telomerase.
More...