Property Summary

NCBI Gene PubMed Count 16
Grant Count 17
R01 Count 12
Funding $2,958,634.24
PubMed Score 159.98
PubTator Score 41.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 0.000

Gene RIF (10)

PMID Text
26814419 RAET1E promoter polymorphism has increased to nine types, and there are now 12 alleles determined by the coding exons, including one null.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20219610 genetic polymorphism among the ethnic groups
20219610 Observational study of genotype prevalence. (HuGE Navigator)
20054857 Patients whose tumors had high expression of RAET1E, ULBP1 and ULBP3 surviving a median of 11, 14 and 11 months, respectively, compared with disease-specific survival of 29, 30 and 25 months in patients whose tumors showed no expression of these ligands
19688209 Observational study of genotype prevalence. (HuGE Navigator)
19436053 data suggest that ULBP4 functions as a ligand for both TCRgammadelta and NKG2D and may play a key role in immune surveillance of tumor development and clearance of viral infection
18544572 All ULBP4 splice variants (ULBP4-I, ULBP4-II and ULBP4-III) were type 1 membrane-spanning molecules and had the ability to bind with human NKG2D receptor in vitro
17470428 immune escape mechanism of tumors via alternative splicing of ULBP RNA to generate a free soluble ULBP protein, RAET1E2, that may impair NKG2D-mediated NK cell cytotoxicity to tumors
15240696 Binds the activating receptor NKG2D.

AA Sequence

MRRISLTSSPVRLLLFLLLLLIALEIMVGGHSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNM      1 - 70
VKPLGLLGKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQF     71 - 140
ATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSP    141 - 210
VNASDIHWSSSSLPDRWIILGAFILLVLMGIVLICVWWQNGEWQAGLWPLRTS                     211 - 263
//

Text Mined References (16)

PMID Year Title
26814419 2016 Increasing polymorphism of the RAET1E/ULBP4 gene in humans.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20219610 2010 Single nucleotide polymorphism analysis of the NKG2D ligand cluster on the long arm of chromosome 6: Extensive polymorphisms and evidence of diversity between human populations.
20054857 2010 ULBP2 and RAET1E NKG2D ligands are independent predictors of poor prognosis in ovarian cancer patients.
19688209 2009 Polymorphisms of NKG2D ligands: diverse RAET1/ULBP genes in northeastern Thais.
19436053 2009 The NKG2D ligand ULBP4 binds to TCRgamma9/delta2 and induces cytotoxicity to tumor cells through both TCRgammadelta and NKG2D.
18544572 2008 Four novel ULBP splice variants are ligands for human NKG2D.
17470428 2007 RAET1E2, a soluble isoform of the UL16-binding protein RAET1E produced by tumor cells, inhibits NKG2D-mediated NK cytotoxicity.
15240696 2004 Two human ULBP/RAET1 molecules with transmembrane regions are ligands for NKG2D.
15026360 2004 Ovarian carcinoma expresses the NKG2D ligand Letal and promotes the survival and expansion of CD28- antitumor T cells.
More...