Property Summary

NCBI Gene PubMed Count 20
PubMed Score 19.52
PubTator Score 52.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Atopic dermatitis -1.700 1.2e-03
Breast cancer -1.200 7.9e-04
breast carcinoma 2.000 1.2e-03
ependymoma 1.500 1.4e-02
fibroadenoma 2.000 1.3e-03
interstitial cystitis -3.400 1.6e-02
intraductal papillary-mucinous adenoma (... 2.500 7.1e-03
intraductal papillary-mucinous carcinoma... 2.600 7.8e-03
intraductal papillary-mucinous neoplasm ... 2.400 4.6e-02
invasive ductal carcinoma 4.500 5.6e-03
lung adenocarcinoma -2.300 2.3e-08
lung carcinoma -3.600 1.0e-23
nasopharyngeal carcinoma -3.700 4.3e-06
non-small cell lung cancer -3.702 2.2e-13
pancreatic cancer 2.200 2.8e-03
pituitary cancer -3.600 1.1e-03
primary pancreatic ductal adenocarcinoma 2.409 3.0e-02
psoriasis -1.300 2.4e-13
urothelial carcinoma -3.700 9.3e-05

Gene RIF (9)

AA Sequence

MMLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLED      1 - 70
CQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRL     71 - 140
YTYEPRDLPLLIENMKKALRLIQSEL                                                141 - 166
//

Text Mined References (23)

PMID Year Title