Property Summary

NCBI Gene PubMed Count 19
Grant Count 15
R01 Count 11
Funding $1,824,500.75
PubMed Score 18.03
PubTator Score 52.13

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
25875093 Data show the potential usability of anterior gradient homolog 3 (AGR3) and anterior gradient homolog 2 (AGR2) as biomarkers for blood-based early detection of breast cancer.
25868611 transcriptionally activated in hepatitis C virus-infected cells by HCV NS5A
25751668 AGR3 is a specialized member of the PDI family that plays an unexpected role in the regulation of CBF and mucociliary clearance in the airway.
25666661 Relying on available data and in silico analyses, study shows that AGR2 and AGR3 proteins are co-expressed or uncoupled in context-dependent manners in diverse carcinomas and healthy tissues.
24747240 AGR3 was is predominantly expressed in liver cholangiocytes but not present in liver hepatocytes, making this protain a good marker for differential diagnosis of intrahepatic cholangiocarcinoma
22361111 AGR3 expression in ovarian cancer is independent of oestrogen-receptor expression.
21451362 AGR3 could serve as a prognostic marker for survival in patients with low grade and high grade serous ovarian carcinomas.
15935701 specific induction of Hag2 and Hag3 during hormone-induced breast carcinomas further support developmental specificity for the PDI/ERp family members
12592373 hAG-2 and hAG-3, human homologues of genes involved in differentiation, are associated with oestrogen receptor-positive breast tumours and interact with metastasis gene C4.4a and dystroglycan [hAG-3 protein]

AA Sequence

MMLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLED      1 - 70
CQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRL     71 - 140
YTYEPRDLPLLIENMKKALRLIQSEL                                                141 - 166
//

Text Mined References (22)

PMID Year Title
26170690 2015 Anterior gradient protein 3 is associated with less aggressive tumors and better outcome of breast cancer patients.
25875093 2015 AGR3 in breast cancer: prognostic impact and suitable serum-based biomarker for early cancer detection.
25868611 2015 The NS5A protein of hepatitis C virus transcriptionally upregulates the AGR3 gene expression.
25751668 2015 The Endoplasmic Reticulum Resident Protein AGR3. Required for Regulation of Ciliary Beat Frequency in the Airway.
25666661 The role of AGR2 and AGR3 in cancer: similar but not identical.
25416956 2014 A proteome-scale map of the human interactome network.
24747240 2014 Differential expression of anterior gradient protein 3 in intrahepatic cholangiocarcinoma and hepatocellular carcinoma.
23386860 2013 Exploring genome-wide - dietary heme iron intake interactions and the risk of type 2 diabetes.
23294566 2013 Anterior gradient 2 and 3--two prototype androgen-responsive genes transcriptionally upregulated by androgens and by oestrogens in prostate cancer cells.
22361111 2012 Anterior Gradient-3: a novel biomarker for ovarian cancer that mediates cisplatin resistance in xenograft models.
More...