Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.23
PubTator Score 2.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.200 2.0e-04
breast carcinoma -1.100 3.8e-04
ductal carcinoma in situ -1.100 7.9e-03
fibroadenoma -1.100 4.4e-02
group 3 medulloblastoma -1.400 4.9e-06
invasive ductal carcinoma -1.400 1.4e-02
lung carcinoma 1.300 5.0e-32
medulloblastoma, large-cell -1.900 3.5e-05
pancreatic ductal adenocarcinoma liver m... -1.974 1.1e-03
primitive neuroectodermal tumor -1.100 4.5e-03

Gene RIF (2)

AA Sequence

MVAWRSAFLVCLAFSLATLVQRGSGDFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSG      1 - 70
LDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIA     71 - 140
GGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEPGTIAGVASALAMALIGAVSSYISYQQ    141 - 210
KKFCFSIQQGLNADYVKGENLEAVVCEEPQVKYSTLHTQSAEPPPPPEPARI                      211 - 262
//

Text Mined References (17)

PMID Year Title