Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.57
PubTator Score 2.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 4.96005821702049E-32
sonic hedgehog group medulloblastoma 1482 2.88274227271349E-8
medulloblastoma, large-cell 6234 3.46884483658393E-5
adult high grade glioma 2148 1.99660057590595E-4
breast carcinoma 1614 3.84656718045196E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0010591183688297
ductal carcinoma in situ 1745 0.00149747083103955
invasive ductal carcinoma 2950 0.00286681463719579
primitive neuroectodermal tumor 3031 0.00445709065014588
fibroadenoma 557 0.0444422208153619
Disease Target Count Z-score Confidence
Cerebral palsy 28 3.005 1.5

Expression

  Differential Expression (10)

Synonym

Gene

PANTHER Protein Class (1)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Horse EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken EggNOG Inparanoid
Anole lizard EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
25666757 This study identified predicted pathogenic, hemizygous variants on chromosome X in disease genes CD99L2.

AA Sequence

MVAWRSAFLVCLAFSLATLVQRGSGDFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSG      1 - 70
LDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIA     71 - 140
GGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEPGTIAGVASALAMALIGAVSSYISYQQ    141 - 210
KKFCFSIQQGLNADYVKGENLEAVVCEEPQVKYSTLHTQSAEPPPPPEPARI                      211 - 262
//

Text Mined References (17)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25666757 2015 Whole-exome sequencing points to considerable genetic heterogeneity of cerebral palsy.
25416956 2014 A proteome-scale map of the human interactome network.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18163232 The murine CD99-related molecule CD99-like 2 (CD99L2) is an adhesion molecule involved in the inflammatory response.
16381901 2006 The LIFEdb database in 2006.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
More...