Property Summary

NCBI Gene PubMed Count 13
Grant Count 5
Funding $1,011,059
PubMed Score 7.57
PubTator Score 2.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (1)

PMID Text
25666757 This study identified predicted pathogenic, hemizygous variants on chromosome X in disease genes CD99L2.

AA Sequence

MVAWRSAFLVCLAFSLATLVQRGSGDFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSG      1 - 70
LDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIA     71 - 140
GGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEPGTIAGVASALAMALIGAVSSYISYQQ    141 - 210
KKFCFSIQQGLNADYVKGENLEAVVCEEPQVKYSTLHTQSAEPPPPPEPARI                      211 - 262
//

Text Mined References (17)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25666757 2015 Whole-exome sequencing points to considerable genetic heterogeneity of cerebral palsy.
25416956 2014 A proteome-scale map of the human interactome network.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18163232 The murine CD99-related molecule CD99-like 2 (CD99L2) is an adhesion molecule involved in the inflammatory response.
16381901 2006 The LIFEdb database in 2006.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
More...