Property Summary

NCBI Gene PubMed Count 24
PubMed Score 4145.94
PubTator Score 448.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
GLUCOCORTICOID DEFICIENCY 2 1 0.0 0.0
Disease Target Count
GLUCOCORTICOID DEFICIENCY 1 5
Disease Target Count
Familial glucocorticoid deficiency 4

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.200 6.6e-09
adrenocortical adenoma -1.356 3.9e-02
adrenocortical carcinoma -2.962 5.3e-04
breast carcinoma -1.900 5.7e-03
ductal carcinoma in situ -2.900 3.8e-04
fibroadenoma -2.900 1.9e-02
invasive ductal carcinoma -3.400 1.2e-03
osteosarcoma -1.050 3.9e-03
posterior fossa group A ependymoma 1.200 5.1e-05

Gene RIF (21)

AA Sequence

MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYMSWSASPQMRN      1 - 70
SPKHHQTCPWSHGLNLHLCIQKCLPCHREPLATSQAQASSVEPGSRTGPDQPLRQESSSTLPLGGFQTHP     71 - 140
TLLWELTLNGGPLVRSKPSEPPPGDRTSQLQS                                          141 - 172
//

Text Mined References (24)

PMID Year Title