Property Summary

NCBI Gene PubMed Count 8
Grant Count 20
R01 Count 15
Funding $886,542.28
PubMed Score 6.03
PubTator Score 3.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma 1.200 0.001
lung adenocarcinoma 1.500 0.000
inflammatory breast cancer 1.100 0.018
ovarian cancer -1.200 0.000

Gene RIF (2)

PMID Text
19403673 The isolated Bro1 domains of HD-PTP and rhophilin both bind to HIV-1 NC and share the capacity to stimulate VLP production by a minimal HIV-1 Gag molecule
19403673 The isolated Bro1 domains of HD-PTP and rhophilin both bind to HIV-1 NC and share the capacity to stimulate VLP production by a minimal HIV-1 Gag molecule

AA Sequence

MILEERPDGAGAGEESPRLQGCDSLTQIQCGQLQSRRAQIHQQIDKELQMRTGAENLYRATSNNRVRETV      1 - 70
ALELSYVNSNLQLLKEELEELSGGVDPGRHGSEAVTVPMIPLGLKETKELDWSTPLKELISVHFGEDGAS     71 - 140
YEAEIRELEALRQAMRTPSRNESGLELLTAYYNQLCFLDARFLTPARSLGLFFHWYDSLTGVPAQQRALA    141 - 210
FEKGSVLFNIGALHTQIGARQDRSCTEGARRAMEAFQRAAGAFSLLRENFSHAPSPDMSAASLCALEQLM    211 - 280
MAQAQECVFEGLSPPASMAPQDCLAQLRLAQEAAQVAAEYRLVHRTMAQPPVHDYVPVSWTALVHVKAEY    281 - 350
FRSLAHYHVAMALCDGSRECPPHLPMVLPRPPRAGSQPLCPPAATEGELPTHEQVFLQPPTSSKPRGPVL    351 - 420
PQELEERRQLGKAHLKRAILGQEEALRLHALCRVLREVDLLRAVISQTLQRSLAKYAELDREDDFCEAAE    421 - 490
APDIQPKTHQKPEARMPRLSQGKGPDIFHRLGPLSVFSAKNRWRLVGPVHLTRGEGGFGLTLRGDSPVLI    491 - 560
AAVIPGSQAAAAGLKEGDYIVSVNGQPCRWWRHAEVVTELKAAGEAGASLQVVSLLPSSRLPSLGDRRPV    561 - 630
LLGPRGLLRSQREHGCKTPASTWASPRPLLNWSRKAQQGKTGGCPQPCAPVKPAPPSSLKHPGWP         631 - 695
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14749388 2004 Human CNK1 acts as a scaffold protein, linking Rho and Ras signal transduction pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221077 2002 The RhoA-binding protein, rhophilin-2, regulates actin cytoskeleton organization.
11572484 2001 Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins.
10591629 2000 Ropporin, a sperm-specific binding protein of rhophilin, that is localized in the fibrous sheath of sperm flagella.