Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.03
PubTator Score 3.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Polycystic ovary syndrome 360 0.0 0.0
Disease Target Count P-value
lung adenocarcinoma 2716 1.9e-06
ovarian cancer 8520 1.2e-04
breast carcinoma 1638 6.1e-04
inflammatory breast cancer 286 1.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Opisthorchiasis 15 4.131 2.1

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma 1.200 6.1e-04
inflammatory breast cancer 1.100 1.8e-02
lung adenocarcinoma 1.500 1.9e-06
ovarian cancer -1.200 1.2e-04

Synonym

Accession Q8TCX5 Q8TAV1 Q96PV9
Symbols ODF5
RHPN
RHOPHILIN

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MILEERPDGAGAGEESPRLQGCDSLTQIQCGQLQSRRAQIHQQIDKELQMRTGAENLYRATSNNRVRETV      1 - 70
ALELSYVNSNLQLLKEELEELSGGVDPGRHGSEAVTVPMIPLGLKETKELDWSTPLKELISVHFGEDGAS     71 - 140
YEAEIRELEALRQAMRTPSRNESGLELLTAYYNQLCFLDARFLTPARSLGLFFHWYDSLTGVPAQQRALA    141 - 210
FEKGSVLFNIGALHTQIGARQDRSCTEGARRAMEAFQRAAGAFSLLRENFSHAPSPDMSAASLCALEQLM    211 - 280
MAQAQECVFEGLSPPASMAPQDCLAQLRLAQEAAQVAAEYRLVHRTMAQPPVHDYVPVSWTALVHVKAEY    281 - 350
FRSLAHYHVAMALCDGSRECPPHLPMVLPRPPRAGSQPLCPPAATEGELPTHEQVFLQPPTSSKPRGPVL    351 - 420
PQELEERRQLGKAHLKRAILGQEEALRLHALCRVLREVDLLRAVISQTLQRSLAKYAELDREDDFCEAAE    421 - 490
APDIQPKTHQKPEARMPRLSQGKGPDIFHRLGPLSVFSAKNRWRLVGPVHLTRGEGGFGLTLRGDSPVLI    491 - 560
AAVIPGSQAAAAGLKEGDYIVSVNGQPCRWWRHAEVVTELKAAGEAGASLQVVSLLPSSRLPSLGDRRPV    561 - 630
LLGPRGLLRSQREHGCKTPASTWASPRPLLNWSRKAQQGKTGGCPQPCAPVKPAPPSSLKHPGWP         631 - 695
//

Text Mined References (9)

PMID Year Title