Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.43
PubTator Score 5.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Short Rib-Polydactyly Syndrome 13 0.0 0.0
Disease Target Count P-value
psoriasis 6694 1.5e-09
ovarian cancer 8520 1.2e-05
Pick disease 1894 1.8e-04
ependymoma 4679 2.2e-03
interstitial cystitis 2312 2.7e-03
osteosarcoma 7950 4.0e-03
progressive supranuclear palsy 676 1.5e-02
chronic rhinosinusitis 512 3.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Polydactyly 107 4.316 2.2
Bardet-Biedl syndrome 51 3.292 1.6

Expression

  Differential Expression (8)

Disease log2 FC p
chronic rhinosinusitis -1.209 3.3e-02
ependymoma 1.200 2.2e-03
interstitial cystitis -1.100 2.7e-03
osteosarcoma 1.150 4.0e-03
ovarian cancer -1.600 1.2e-05
Pick disease -1.100 1.8e-04
progressive supranuclear palsy -1.100 1.5e-02
psoriasis -1.400 1.5e-09

Protein-protein Interaction (5)

Gene RIF (3)

AA Sequence

MPSETLWEIAKAEVEKRGINGSEGDGAEIAEKFVFFIGSKNGGKTTIILRCLDRDEPPKPTLALEYTYGR      1 - 70
RAKGHNTPKDIAHFWELGGGTSLLDLISIPITGDTLRTFSLVLVLDLSKPNDLWPTMENLLQATKSHVDK     71 - 140
VIMKLGKTNAKAVSEMRQKIWNNMPKDHPDHELIDPFPVPLVIIGSKYDVFQDFESEKRKVICKTLRFVA    141 - 210
HYYGASLMFTSKSEALLLKIRGVINQLAFGIDKSKSICVDQNKPLFITAGLDSFGQIGSPPVPENDIGKL    211 - 280
HAHSPMELWKKVYEKLFPPKSINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKSWKQIELD    281 - 350
S//

Text Mined References (16)

PMID Year Title