Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.28
PubTator Score 2.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Type 2 diabetes mellitus 189 1.0

Expression

Gene RIF (4)

PMID Text
23834954 associations revealed between genetic polymorphisms located in the flanking region of the ARID1B genes and hypoesthesia
20950786 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
18632209 this protein may be part of the complex signaling pathway implicated in cerebral cavernous malformation formation

AA Sequence

MEQIWLLLLLTIRVLPGSAQFNGYNCDANLHSRFPAERDISVYCGVQAITMKINFCTVLFSGYSETDLAL      1 - 70
NGRHGDSHCRGFINNNTFPAVVIFIINLSTLEGCGNNLVVSTIPGVSAYGNATSVQVGNISGYIDTPDPP     71 - 140
TIISYLPGLLYKFSCSYPLEYLVNNTQLASSSAAISVRENNGTFVSTLNLLLYNDSTYNQQLIIPSIGLP    141 - 210
LKTKVFAAVQATNLDGRWNVLMDYCYTTPSGNPNDDIRYDLFLSCDKDPQTTVIENGRSQRGRFSFEVFR    211 - 280
FVKHKNQKMSTVFLHCVTKLCRADDCPFLMPICSHRERRDAGRRTTWSPQSSSGSAVLSAGPIITRSDET    281 - 350
PTNNSQLGSPSMPPFQLNAITSALISGMVILGVTSFSLLLCSLALLHRKGPTSLVLNGIRNPVFD         351 - 415
//

Text Mined References (8)

PMID Year Title
23834954 2013 Genome-wide association study of sensory disturbances in the inferior alveolar nerve after bilateral sagittal split ramus osteotomy.
23192594 2013 Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study.
21490949 2011 Transferability of type 2 diabetes implicated loci in multi-ethnic cohorts from Southeast Asia.
20950786 2010 A genome-wide study reveals copy number variants exclusive to childhood obesity cases.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18632209 2008 ZPLD1 gene is disrupted in a patient with balanced translocation that exhibits cerebral cavernous malformations.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.