Property Summary

NCBI Gene PubMed Count 47
Grant Count 16
R01 Count 16
Funding $673,368.04
PubMed Score 41.99
PubTator Score 38.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
osteosarcoma -1.009 0.028
atypical teratoid/rhabdoid tumor -1.400 0.000
medulloblastoma, large-cell -1.500 0.001
non-small cell lung cancer -1.323 0.000
intraductal papillary-mucinous carcinoma... -1.100 0.001
breast carcinoma 1.200 0.004
fibroadenoma 1.100 0.013
interstitial cystitis 1.600 0.004
group 4 medulloblastoma -1.300 0.011
subependymal giant cell astrocytoma -1.209 0.047
lung adenocarcinoma -1.700 0.000
invasive ductal carcinoma 1.010 0.000
lung carcinoma -2.000 0.000
ulcerative colitis 1.700 0.000
ovarian cancer 1.500 0.000
Breast cancer -1.200 0.014

Gene RIF (32)

PMID Text
26797121 P-Rex1 contributes to the spatiotemporal localization of type I PKA, which tightly regulates this guanine exchange factor by a multistep mechanism.
26621702 findings suggest a vital role of P-Rex1 signaling in CA1 LTD that is critical for social behavior and cognitive function and offer new insight into the etiology of ASDs
26112412 The P-Rex1-Rac1 interface is critical for Rac1 activation in breast cancer cells.
25284585 P-REX1 promotes both PI3K/AKT and MEK/ERK signaling in breast cancer.
25248717 PREX1 gene promoter hypomethylation is a prognostic marker of poor patient survival.
23899556 Phosphorylation of P-Rex1 at serine 1169 participates in IGF-1R signaling in breast cancer cells.
23478800 Cucurbitacin I also failed to affect the activation of P-Rex1 by heregulin.
23382862 These data suggest that P-Rex1 has an influence on physiological migratory processes, such as invasion of cancer cells, both through effects upon classical Rac1-driven motility and a novel association with RTK signalling complexes.
23033535 Studies indicate relevance of P-Rex1 and P-Rex2a, in breast tumorigenesis, and suggest that the exchange factors Vav2 and Vav3 play synergistic roles in breast cancer by sustaining tumor growth, neoangiogenesis, and metastasis.
22242915 We have identified a novel mechanism for direct activation of P-Rex1 through PP1alpha-dependent dephosphorylation.
More...

AA Sequence

MEAPSGSEPGGDGAGDCAHPDPRAPGAAAPSSGPGPCAAARESERQLRLRLCVLNEILGTERDYVGTLRF      1 - 70
LQSAFLHRIRQNVADSVEKGLTEENVKVLFSNIEDILEVHKDFLAALEYCLHPEPQSQHELGNVFLKFKD     71 - 140
KFCVYEEYCSNHEKALRLLVELNKIPTVRAFLLSCMLLGGRKTTDIPLEGYLLSPIQRICKYPLLLKELA    141 - 210
KRTPGKHPDHPAVQSALQAMKTVCSNINETKRQMEKLEALEQLQSHIEGWEGSNLTDICTQLLLQGTLLK    211 - 280
ISAGNIQERAFFLFDNLLVYCKRKSRVTGSKKSTKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHS    281 - 350
NGYTVTNGWKIHNTAKNKWFVCMAKTAEEKQKWLDAIIREREQRESLKLGMERDAYVMIAEKGEKLYHMM    351 - 420
MNKKVNLIKDRRRKLSTVPKCFLGNEFVAWLLEIGEISKTEEGVNLGQALLENGIIHHVSDKHQFKNEQV    421 - 490
MYRFRYDDGTYKARSELEDIMSKGVRLYCRLHSLYTPVIKDRDYHLKTYKSVLPGSKLVDWLLAQGDCQT    491 - 560
REEAVALGVGLCNNGFMHHVLEKSEFRDESQYFRFHADEEMEGTSSKNKQLRNDFKLVENILAKRLLILP    561 - 630
QEEDYGFDIEEKNKAVVVKSVQRGSLAEVAGLQVGRKIYSINEDLVFLRPFSEVESILNQSFCSRRPLRL    631 - 700
LVATKAKEIIKIPDQPDTLCFQIRGAAPPYVYAVGRGSEAMAAGLCAGQCILKVNGSNVMNDGAPEVLEH    701 - 770
FQAFRSRREEALGLYQWIYHTHEDAQEARASQEASTEDPSGEQAQEEDQADSAFPLLSLGPRLSLCEDSP    771 - 840
MVTLTVDNVHLEHGVVYEYVSTAGVRCHVLEKIVEPRGCFGLTAKILEAFAANDSVFVENCRRLMALSSA    841 - 910
IVTMPHFEFRNICDTKLESIGQRIACYQEFAAQLKSRVSPPFKQAPLEPHPLCGLDFCPTNCHINLMEVS    911 - 980
YPKTTPSVGRSFSIRFGRKPSLIGLDPEQGHLNPMSYTQHCITTMAAPSWKCLPAAEGDPQGQGLHDGSF    981 - 1050
GPASGTLGQEDRGLSFLLKQEDREIQDAYLQLFTKLDVALKEMKQYVTQINRLLSTITEPTSGGSCDASL   1051 - 1120
AEEASSLPLVSEESEMDRSDHGGIKKVCFKVAEEDQEDSGHDTMSYRDSYSECNSNRDSVLSYTSVRSNS   1121 - 1190
SYLGSDEMGSGDELPCDMRIPSDKQDKLHGCLEHLFNQVDSINALLKGPVMSRAFEETKHFPMNHSLQEF   1191 - 1260
KQKEECTIRGRSLIQISIQEDPWNLPNSIKTLVDNIQRYVEDGKNQLLLALLKCTDTELQLRRDAIFCQA   1261 - 1330
LVAAVCTFSKQLLAALGYRYNNNGEYEESSRDASRKWLEQVAATGVLLHCQSLLSPATVKEERTMLEDIW   1331 - 1400
VTLSELDNVTFSFKQLDENYVANTNVFYHIEGSRQALKVIFYLDSYHFSKLPSRLEGGASLRLHTALFTK   1401 - 1470
VLENVEGLPSPGSQAAEDLQQDINAQSLEKVQQYYRKLRAFYLERSNLPTDASTTAVKIDQLIRPINALD   1471 - 1540
ELCRLMKSFVHPKPGAAGSVGAGLIPISSELCYRLGACQMVMCGTGMQRSTLSVSLEQAAILARSHGLLP   1541 - 1610
KCIMQATDIMRKQGPRVEILAKNLRVKDQMPQGAPRLYRLCQPPVDGDL                        1611 - 1659
//

Text Mined References (50)

PMID Year Title
26797121 2016 Protein Kinase A (PKA) Type I Interacts with P-Rex1, a Rac Guanine Nucleotide Exchange Factor: EFFECT ON PKA LOCALIZATION AND P-Rex1 SIGNALING.
26621702 2015 Synaptic P-Rex1 signaling regulates hippocampal long-term depression and autism-like social behavior.
26112412 2015 The Phosphatidylinositol (3,4,5)-Trisphosphate-dependent Rac Exchanger 1·Ras-related C3 Botulinum Toxin Substrate 1 (P-Rex1·Rac1) Complex Reveals the Basis of Rac1 Activation in Breast Cancer Cells.
25284585 2015 P-REX1 creates a positive feedback loop to activate growth factor receptor, PI3K/AKT and MEK/ERK signaling in breast cancer.
25248717 2014 Subtype-specific overexpression of the Rac-GEF P-REX1 in breast cancer is associated with promoter hypomethylation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23899556 2013 Phosphorylation of P-Rex1 at serine 1169 participates in IGF-1R signaling in breast cancer cells.
23496005 2013 Clinical, polysomnographic and genome-wide association analyses of narcolepsy with cataplexy: a European Narcolepsy Network study.
23478800 2013 Cucurbitacin I inhibits Rac1 activation in breast cancer cells by a reactive oxygen species-mediated mechanism and independently of Janus tyrosine kinase 2 and P-Rex1.
23382862 2013 P-Rex1 cooperates with PDGFR? to drive cellular migration in 3D microenvironments.
More...