Property Summary

NCBI Gene PubMed Count 58
Grant Count 63
R01 Count 17
Funding $17,114,659.17
PubMed Score 79.90
PubTator Score 50.09

Knowledge Summary

Patent (3,964)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.700 0.002
ependymoma -2.600 0.000
glioblastoma -3.100 0.000
atypical teratoid / rhabdoid tumor -3.100 0.000
medulloblastoma -2.300 0.005
medulloblastoma, large-cell -2.100 0.050
primitive neuroectodermal tumor -2.600 0.004
pediatric high grade glioma -2.500 0.000
pilocytic astrocytoma -2.600 0.000
psoriasis -1.500 0.000

Synonym

Accession Q8TCU5 B3DLF9 Q5VTR3 Q8TF29 Q8WXI6 GluN3A
Symbols NR3A
GluN3A
NMDAR-L

Gene

Gene RIF (68)

PMID Text
26265699 Single nucleotide polymorphism in GRIN3A is associated with osteonecrosis in children with acute lymphoblastic leukemia.
25450229 The rare variants in GRIN3A were significantly associated with smoking status.
25041634 the genetic variations of NR3A subunit of NMDA receptor may be a predisposing factor to delirium among the Polish population of cardiac surgery patients
25017909 Isolated GluN1/GluN3A receptors integrated into lipid bilayers responded to addition of either glycine or d-serine, but not glutamate, with a approximately 1 nm reduction in height of the extracellular domain
24739951 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
24386575 This review highlights GluN3A properties and addresses its role in neurophysiology and associated pathologies--{REVIEW}
24332987 It modulates episodic memory.
24278430 Our results suggest that a polymorphism of the GRIN3A gene may play a role in KD pathogenesis.
24086760 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
23852340 These findings reveal an early pathogenic role of GluN3A dysregulation in Huntington's disease.
More...

AA Sequence

MRRLSLWWLLSRVCLLLPPPCALVLAGVPSSSSHPQPCQILKRIGHAVRVGAVHLQPWTTAPRAASRAPD      1 - 70
DSRAGAQRDEPEPGTRRSPAPSPGARWLGSTLHGRGPPGSRKPGEGARAEALWPRDALLFAVDNLNRVEG     71 - 140
LLPYNLSLEVVMAIEAGLGDLPLLPFSSPSSPWSSDPFSFLQSVCHTVVVQGVSALLAFPQSQGEMMELD    141 - 210
LVSLVLHIPVISIVRHEFPRESQNPLHLQLSLENSLSSDADVTVSILTMNNWYNFSLLLCQEDWNITDFL    211 - 280
LLTQNNSKFHLGSIINITANLPSTQDLLSFLQIQLESIKNSTPTVVMFGCDMESIRRIFEITTQFGVMPP    281 - 350
ELRWVLGDSQNVEELRTEGLPLGLIAHGKTTQSVFEHYVQDAMELVARAVATATMIQPELALIPSTMNCM    351 - 420
EVETTNLTSGQYLSRFLANTTFRGLSGSIRVKGSTIVSSENNFFIWNLQHDPMGKPMWTRLGSWQGGKIV    421 - 490
MDYGIWPEQAQRHKTHFQHPSKLHLRVVTLIEHPFVFTREVDDEGLCPAGQLCLDPMTNDSSTLDSLFSS    491 - 560
LHSSNDTVPIKFKKCCYGYCIDLLEKIAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLRGTAHMAVT    561 - 630
SFSINTARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAVFLTLYEWKSP    631 - 700
FGLTPKGRNRSKVFSFSSALNICYALLFGRTVAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVG    701 - 770
EKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVEYLKNDPEKLD    771 - 840
AFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTANISELISQYKSHGFMDMLHDKWYRV    841 - 910
VPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLLPRIKNKSKLQYWLHTSQRLH    911 - 980
RAINTSFIEEKQQHFKTKRVEKRSNVGPRQLTVWNTSNLSHDNRRKYIFSDEEGQNQLGIRIHQDIPLPP    981 - 1050
RRRELPALRTTNGKADSLNVSRNSVMQELSELEKQIQVIRQELQLAVSRKTELEEYQRTSRTCES        1051 - 1115
//

Text Mined References (60)

PMID Year Title
26265699 2015 Genetics of glucocorticoid-associated osteonecrosis in children with acute lymphoblastic leukemia.
25450229 2015 The contribution of rare and common variants in 30 genes to risk nicotine dependence.
25041634 The assessment of the T102C polymorphism of the 5HT2a receptor gene, 3723G/A polymorphism of the NMDA receptor 3A subunit gene (GRIN3A) and 421C/A polymorphism of the NMDA receptor 2B subunit gene (GRIN2B) among cardiac surgery patients with and without delirium.
25017909 2014 Activation-induced structural change in the GluN1/GluN3A excitatory glycine receptor.
24386575 2013 GluN3A: an NMDA receptor subunit with exquisite properties and functions.
24332987 2014 Dopamine and glutamate receptor genes interactively influence episodic memory in old age.
24278430 2013 Association between GRIN3A gene polymorphism in Kawasaki disease and coronary artery aneurysms in Taiwanese children.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23852340 2013 Suppressing aberrant GluN3A expression rescues synaptic and behavioral impairments in Huntington's disease models.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
More...