Property Summary

Ligand Count 4
NCBI Gene PubMed Count 61
PubMed Score 80.45
PubTator Score 50.09

Knowledge Summary

Patent (3,964)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -2.300 4.5e-03
astrocytic glioma -1.700 2.0e-03
Astrocytoma, Pilocytic -2.700 1.9e-05
atypical teratoid / rhabdoid tumor -3.100 1.3e-06
ependymoma -1.500 6.3e-03
glioblastoma -2.500 5.2e-08
medulloblastoma -2.300 5.0e-03
medulloblastoma, large-cell -2.100 5.0e-02
primitive neuroectodermal tumor -2.600 4.5e-03
psoriasis -1.500 5.3e-51

 IMPC Phenotype (1)

Gene RIF (70)

AA Sequence

MRRLSLWWLLSRVCLLLPPPCALVLAGVPSSSSHPQPCQILKRIGHAVRVGAVHLQPWTTAPRAASRAPD      1 - 70
DSRAGAQRDEPEPGTRRSPAPSPGARWLGSTLHGRGPPGSRKPGEGARAEALWPRDALLFAVDNLNRVEG     71 - 140
LLPYNLSLEVVMAIEAGLGDLPLLPFSSPSSPWSSDPFSFLQSVCHTVVVQGVSALLAFPQSQGEMMELD    141 - 210
LVSLVLHIPVISIVRHEFPRESQNPLHLQLSLENSLSSDADVTVSILTMNNWYNFSLLLCQEDWNITDFL    211 - 280
LLTQNNSKFHLGSIINITANLPSTQDLLSFLQIQLESIKNSTPTVVMFGCDMESIRRIFEITTQFGVMPP    281 - 350
ELRWVLGDSQNVEELRTEGLPLGLIAHGKTTQSVFEHYVQDAMELVARAVATATMIQPELALIPSTMNCM    351 - 420
EVETTNLTSGQYLSRFLANTTFRGLSGSIRVKGSTIVSSENNFFIWNLQHDPMGKPMWTRLGSWQGGKIV    421 - 490
MDYGIWPEQAQRHKTHFQHPSKLHLRVVTLIEHPFVFTREVDDEGLCPAGQLCLDPMTNDSSTLDSLFSS    491 - 560
LHSSNDTVPIKFKKCCYGYCIDLLEKIAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLRGTAHMAVT    561 - 630
SFSINTARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAVFLTLYEWKSP    631 - 700
FGLTPKGRNRSKVFSFSSALNICYALLFGRTVAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVG    701 - 770
EKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVEYLKNDPEKLD    771 - 840
AFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTANISELISQYKSHGFMDMLHDKWYRV    841 - 910
VPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLLPRIKNKSKLQYWLHTSQRLH    911 - 980
RAINTSFIEEKQQHFKTKRVEKRSNVGPRQLTVWNTSNLSHDNRRKYIFSDEEGQNQLGIRIHQDIPLPP    981 - 1050
RRRELPALRTTNGKADSLNVSRNSVMQELSELEKQIQVIRQELQLAVSRKTELEEYQRTSRTCES        1051 - 1115
//

Text Mined References (64)

PMID Year Title