Property Summary

NCBI Gene PubMed Count 61
PubMed Score 120.21
PubTator Score 75.68

Knowledge Summary


No data available


  Disease Sources (6)

Disease Target Count P-value
osteosarcoma 7933 9.59406356582415E-8
malignant mesothelioma 3163 2.25770865801405E-7
Pick disease 1893 4.14540934934192E-7
group 3 medulloblastoma 2254 1.25732365322831E-5
primitive neuroectodermal tumor 3031 9.22318040972683E-5
psoriasis 6685 3.93676978985909E-4
medulloblastoma, large-cell 6234 7.1693628897574E-4
oligodendroglioma 2849 0.00125537333162878
ependymoma 2514 0.00211225213406448
astrocytic glioma 2241 0.00297113048306643
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00372154481995925
Multiple myeloma 1328 0.00900242129438198
lung cancer 4473 0.00905606252894409
chronic rhinosinusitis 512 0.0112456989561169
cystic fibrosis and chronic rhinosinusitis 213 0.043832814611995
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
cone-rod dystrophy 60 5.099 2.5
Obesity 616 3.904 2.0
diabetes mellitus 1663 3.269 1.6
Disease Target Count
Alstrom syndrome 7


  Differential Expression (15)

Disease log2 FC p
Multiple myeloma -1.207 0.009
malignant mesothelioma 2.200 0.000
astrocytic glioma 2.200 0.003
ependymoma 2.300 0.002
oligodendroglioma 2.200 0.001
psoriasis 1.500 0.000
osteosarcoma 2.210 0.000
group 3 medulloblastoma 2.100 0.000
medulloblastoma, large-cell 1.300 0.001
primitive neuroectodermal tumor 1.800 0.000
pancreatic ductal adenocarcinoma liver m... 1.692 0.004
lung cancer 1.100 0.009
Pick disease 1.200 0.000
chronic rhinosinusitis -1.206 0.011
cystic fibrosis and chronic rhinosinusit... -1.016 0.044


Accession Q8TCU4 Q53S05 Q580Q8 Q86VP9 Q9Y4G4
Symbols ALSS


  Ortholog (5)

Species Source
Chimp OMA Inparanoid
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid

Gene RIF (39)

26957854 Two novel mutations causing phenotypic LCA and Alstrom syndrome in Saudi patients from consanguineous families expand the genotypic spectrum of congenital retinal dystrophies.
26077327 We conclude that two independent mutations in ALMS1 and DYSF cause CRD and muscular dystrophy in the studied consanguineous Israeli Arab family.
25864795 In this study, we have characterized the presenting ophthalmic phenotype of young children molecularly confirmed to harbor recessive homozygous ALMS1 mutations but not yet diagnosed with Alstrom syndrome.
25846608 The study represents the most comprehensive mutation analysis in patients with Alstrom Syndrome, identifying the largest number of novel mutations in a single study worldwide.
25296579 ALMS has a relatively high incidence in Turkey and the present study shows that the ALMS1 mutations are largely heterogeneous. In addition, 49 variants of uncertain pathogenicity were noted, and four of these were very rare.
24972238 Identification of a homozygous deleterious mutation in the ALMS1 gene as the cause of mitogenic cardiomyopathy in two siblings.
24681783 regulates Notch activation and the accumulation of receptor in late endosomes
24595103 Data conclude that deficiency of Alstrom protein impairs postnatal cardiomyocyte cell cycle arrest.
24503146 Our study expands the clinical spectrum associated with ALMS1 mutations and supports complete ALMS1 gene sequencing in children that present with infantile cardiomyopathy and retinopathy.
24319333 A novel ALMS1 mutation (p.Q2051X) causes Alstrom syndrome in two Japanese brothers but spares their heterozygous parents.

AA Sequence

KREEEKRKSEYKSYRLRAQLYKKRVTNQLLGRKVPWD                                    4131 - 4167

Text Mined References (64)

PMID Year Title
26957854 Novel Mutations in Two Saudi Patients with Congenital Retinal Dystrophy.
26077327 2015 Nonsyndromic Early-Onset Cone-Rod Dystrophy and Limb-Girdle Muscular Dystrophy in a Consanguineous Israeli Family are Caused by Two Independent yet Linked Mutations in ALMS1 and DYSF.
25864795 2015 Ophthalmic Features of Children Not Yet Diagnosed with Alstrom Syndrome.
25846608 2015 Alström Syndrome: Mutation Spectrum of ALMS1.
25296579 2015 The phenotypic and molecular genetic spectrum of Alström syndrome in 44 Turkish kindreds and a literature review of Alström syndrome in Turkey.
24972238 2014 Homozygous loss-of-function mutation in ALMS1 causes the lethal disorder mitogenic cardiomyopathy in two siblings.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24681783 2014 Basal body proteins regulate Notch signaling through endosomal trafficking.
24595103 2014 Mutations in Alström protein impair terminal differentiation of cardiomyocytes.
24586186 2014 Genome-wide association study of metabolic traits reveals novel gene-metabolite-disease links.