Property Summary

NCBI Gene PubMed Count 33
PubMed Score 278.81
PubTator Score 405.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 1.300 9.3e-16
invasive ductal carcinoma 1.200 1.0e-02
osteosarcoma 2.033 1.6e-04
ovarian cancer 1.200 1.3e-04
pancreatic ductal adenocarcinoma liver m... -1.444 6.1e-03
pituitary cancer -1.500 1.0e-05

Gene RIF (15)

AA Sequence

MDSALSDPHNGSAEAGGPTNSTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSVRCARGKNASDMPETI      1 - 70
TSRDAARFPIIASCTLLGLYLFFKIFSQEYINLLLSMYFFVLGILALSHTISPFMNKFFPASFPNRQYQL     71 - 140
LFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCI    141 - 210
LLGGLFIYDVFWVFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEANNFAMLGLGDVVIPGIFIALLLRFD    211 - 280
ISLKKNTHTYFYTSFAAYIFGLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEVTEMFSYEESN    281 - 350
PKDPAAVTESKEGTEASASKGLEKKEK                                               351 - 377
//

Text Mined References (38)

PMID Year Title