Property Summary

NCBI Gene PubMed Count 31
PubMed Score 296.93
PubTator Score 405.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 2.033 0.000
pancreatic ductal adenocarcinoma liver m... -1.444 0.006
Breast cancer 1.300 0.000
invasive ductal carcinoma 1.200 0.010
ovarian cancer 1.200 0.000
pituitary cancer -1.500 0.000

Synonym

Accession Q8TCT9 B2RAY5 E1P5L3 Q15K36 Q540H8 Q5JWP2 Q5JWP3 Q5JWP4 Q5JWP5 Q7Z4F2 Q86Y35 Q95H87 Q9H110 Q9H111
Symbols H13
SPP
IMP1
PSL3
IMPAS
SPPL1
PSENL3
IMPAS-1
MSTP086

Gene

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Pathway (1)

Gene RIF (12)

PMID Text
22190034 HIV-1 gp160 is identified to have a physical interaction with histocompatibility (minor) 13 (HM13) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21636854 structure of human SPP [SPP]
16834339 Upon isolation of membranes and solubilization with detergent, the biochemical characteristics of SPP are remarkably similar to gamma-secretase.
16738546 data implicate SPP in the US2 pathway and indicate the possibility of a previously unknown function for this intramembrane-cleaving aspartic protease in dislocation from the endoplasmic reticulum
16730383 Compares a variant from the mouse ortholog to the human gene.
15385547 SPP, SPPL2a, -2b, -2c, and -3 probably cleave type II-oriented substrate peptides as shown by consensus analysis
14988012 The peptide structure corresponding to the C-terminal residues from H13 ribosomal protein was determined using magnetic resonance spectroscopy.
14741365 IMP1 is a bi-aspartic polytopic protease capable of cleaving transmembrane proteins such as presenilin 2.
14704149 signal peptide peptidase forms a homodimer that is labeled by an active site-directed gamma-secretase inhibitor
12972007 widespread expression of SPP in many tissues
More...

AA Sequence

MDSALSDPHNGSAEAGGPTNSTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSVRCARGKNASDMPETI      1 - 70
TSRDAARFPIIASCTLLGLYLFFKIFSQEYINLLLSMYFFVLGILALSHTISPFMNKFFPASFPNRQYQL     71 - 140
LFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCI    141 - 210
LLGGLFIYDVFWVFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEANNFAMLGLGDVVIPGIFIALLLRFD    211 - 280
ISLKKNTHTYFYTSFAAYIFGLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEVTEMFSYEESN    281 - 350
PKDPAAVTESKEGTEASASKGLEKKEK                                               351 - 377
//

Text Mined References (36)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25239945 2014 Signal peptide peptidase functions in ERAD to cleave the unfolded protein response regulator XBP1u.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21636854 2011 Three-dimensional structure of the signal peptide peptidase.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19942855 2010 Protein disulphide isomerase is required for signal peptide peptidase-mediated protein degradation.
19720873 2009 The TRC8 E3 ligase ubiquitinates MHC class I molecules before dislocation from the ER.
More...