Property Summary

NCBI Gene PubMed Count 20
PubMed Score 23.90
PubTator Score 12.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
juvenile dermatomyositis 1187 1.6e-14
pituitary cancer 1972 4.6e-05
ovarian cancer 8519 4.7e-05
osteosarcoma 7950 1.6e-04

Expression

  Differential Expression (4)

Disease log2 FC p
juvenile dermatomyositis 1.026 1.6e-14
osteosarcoma -1.140 1.6e-04
ovarian cancer -1.100 4.7e-05
pituitary cancer 1.200 4.6e-05

Gene RIF (10)

AA Sequence

MAEQTYSWAYSLVDSSQVSTFLISILLIVYGSFRSLNMDFENQDKEKDSNSSSGSFNGEQEPIIGFQPMD      1 - 70
STRARFLPMGACVSLLVMFFFFDSVQVVFTICTAVLATIAFAFLLLPMCQYLTRPCSPQNKISFGCCGRF     71 - 140
TAAELLSFSLSVMLVLIWVLTGHWLLMDALAMGLCVAMIAFVRLPSLKVSCLLLSGLLIYDVFWVFFSAY    141 - 210
IFNSNVMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHFSMLGIGDIVMPGLLL    211 - 280
CFVLRYDNYKKQASGDSCGAPGPANISGRMQKVSYFHCTLIGYFVGLLTATVASRIHRAAQPALLYLVPF    281 - 350
TLLPLLTMAYLKGDLRRMWSEPFHSKSSSSRFLEV                                       351 - 385
//

Text Mined References (21)

PMID Year Title