Property Summary

NCBI Gene PubMed Count 12
Grant Count 11
R01 Count 10
Funding $2,791,482
PubMed Score 8.86
PubTator Score 18.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 2.818 0.004

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
1565 confirmatory 3164 / 0 / 285317 uHTS absorbance assay for the identification of compounds that inhibit PHOSPHO1
1574 summary 1 / 0 / 0 Summary assay for the identification of compounds that inhibit PHOSPHO1
1666 confirmatory 28 / 0 / 43 SAR assay for compounds that inhibit PHOSPHO1

Gene RIF (4)

PMID Text
24533943 REVIEW: role of bone-type tissue-nonspecific alkaline phosphatase and PHOSPO1 in vascular calcification
19453261 Observational study of gene-disease association. (HuGE Navigator)
18471996 The identification of a novel, alternatively spliced PHOSPHO1 transcript (PHOSPHO1-3a), was described.
16054448 Models of PHOSPHO2 and PHOSPHO1 suggest subtle differences in the charge distributions around the putative substrate entry site and in the location of potential H-bond donors.

AA Sequence

MSGCFPVSGLRCLSRDGRMAAQGAPRFLLTFDFDETIVDENSDDSIVRAAPGQRLPESLRATYREGFYNE      1 - 70
YMQRVFKYLGEQGVRPRDLSAIYEAIPLSPGMSDLLQFVAKQGACFEVILISDANTFGVESSLRAAGHHS     71 - 140
LFRRILSNPSGPDARGLLALRPFHTHSCARCPANMCKHKVLSDYLRERAHDGVHFERLFYVGDGANDFCP    141 - 210
MGLLAGGDVAFPRRGYPMHRLIQEAQKAEPSSFRASVVPWETAADVRLHLQQVLKSC                 211 - 267
//

Text Mined References (13)

PMID Year Title
24533943 2014 Role of bone-type tissue-nonspecific alkaline phosphatase and PHOSPO1 in vascular calcification.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
19874193 2010 Kinetic analysis of substrate utilization by native and TNAP-, NPP1-, or PHOSPHO1-deficient matrix vesicles.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
18471996 2008 Identification of a novel splice variant of the haloacid dehalogenase: PHOSPHO1.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16054448 2005 Probing the substrate specificities of human PHOSPHO1 and PHOSPHO2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15175005 2004 Human PHOSPHO1 exhibits high specific phosphoethanolamine and phosphocholine phosphatase activities.
15050893 2004 PHOSPHO1-A novel phosphatase specifically expressed at sites of mineralisation in bone and cartilage.
More...