Property Summary

NCBI Gene PubMed Count 41
Grant Count 97
R01 Count 74
Funding $15,071,962.03
PubMed Score 233.01
PubTator Score 102.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 1.266 0.010
juvenile dermatomyositis 1.555 0.000
non-small cell lung cancer 1.355 0.000
Breast cancer 2.900 0.025
nasopharyngeal carcinoma 1.200 0.000
Pick disease -1.300 0.000
progressive supranuclear palsy -1.500 0.005
invasive ductal carcinoma 1.200 0.001
ovarian cancer 2.200 0.000

Synonym

Accession Q8TCS8 Q53SU0 Q68CN1 Q7Z7D1 Q8IWX1 Q96T05 Q9BRU3 Q9BVX0
Symbols OLD35
DFNB70
PNPASE
old-35
COXPD13

Gene

PDB

3U1K  

Gene RIF (28)

PMID Text
24729470 this study provides further evidence that hPNPase(old-35) is associated with global changes in cell cycle-associated genes and identifies potential gene targets for future investigation
24143183 fresh insight into cellular pathways regulated by PNPT1
23221631 Interaction between PNPase and hSuv3 is essential for efficient mitochondrial RNA degradation.
23084291 Mutation in PNPT1, which encodes a polyribonucleotide nucleotidyltransferase, impairs RNA import into mitochondria and causes respiratory-chain deficiency.
23084290 A mutation in PNPT1, encoding mitochondrial-RNA-import protein PNPase, causes hereditary hearing loss.
22815474 a novel role of nEGFR in radioresistance, and that is, upon ionizing radiation, nEGFR inactivates the ribonuclease activity of PNPase toward c-MYC mRNA through DNAPK-mediated Ser-776 phosphorylation
22210891 The study provides structural and functional insights into hPNPase, which uses a KH pore to trap a long RNA 3' tail that is further delivered into an RNase PH channel for the degradation process.
21151174 targeted overexpression of hPNPase(old-35) represents a novel strategy to selectively downregulate RNA expression and consequently intervene in a variety of pathophysiological conditions
20877624 Observational study of gene-disease association. (HuGE Navigator)
20691904 The data support an unanticipated role for PNPASE in mediating the translocation of RNAs into mitochondria.
More...

AA Sequence

MAACRYCCSCLRLRPLSDGPFLLPRRDRALTQLQVRALWSSAGSRAVAVDLGNRKLEISSGKLARFADGS      1 - 70
AVVQSGDTAVMVTAVSKTKPSPSQFMPLVVDYRQKAAAAGRIPTNYLRREIGTSDKEILTSRIIDRSIRP     71 - 140
LFPAGYFYDTQVLCNLLAVDGVNEPDVLAINGASVALSLSDIPWNGPVGAVRIGIIDGEYVVNPTRKEMS    141 - 210
SSTLNLVVAGAPKSQIVMLEASAENILQQDFCHAIKVGVKYTQQIIQGIQQLVKETGVTKRTPQKLFTPS    211 - 280
PEIVKYTHKLAMERLYAVFTDYEHDKVSRDEAVNKIRLDTEEQLKEKFPEADPYEIIESFNVVAKEVFRS    281 - 350
IVLNEYKRCDGRDLTSLRNVSCEVDMFKTLHGSALFQRGQTQVLCTVTFDSLESGIKSDQVITAINGIKD    351 - 420
KNFMLHYEFPPYATNEIGKVTGLNRRELGHGALAEKALYPVIPRDFPFTIRVTSEVLESNGSSSMASACG    421 - 490
GSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIEDYNGDMDFKIAGTNKGITALQAD    491 - 560
IKLPGIPIKIVMEAIQQASVAKKEILQIMNKTISKPRASRKENGPVVETVQVPLSKRAKFVGPGGYNLKK    561 - 630
LQAETGVTISQVDEETFSVFAPTPSAMHEARDFITEICKDDQEQQLEFGAVYTATITEIRDTGVMVKLYP    631 - 700
NMTAVLLHNTQLDQRKIKHPTALGLEVGQEIQVKYFGRDPADGRMRLSRKVLQSPATTVVRTLNDRSSIV    701 - 770
MGEPISQSSSNSQ                                                             771 - 783
//

Text Mined References (47)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
24729470 2014 Analysis of global changes in gene expression induced by human polynucleotide phosphorylase (hPNPase(old-35)).
24143183 2013 Identification of genes potentially regulated by human polynucleotide phosphorylase (hPNPase old-35) using melanoma as a model.
23221631 2013 Human mitochondrial RNA decay mediated by PNPase-hSuv3 complex takes place in distinct foci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23084291 2012 Mutation in PNPT1, which encodes a polyribonucleotide nucleotidyltransferase, impairs RNA import into mitochondria and causes respiratory-chain deficiency.
23084290 2012 A mutation in PNPT1, encoding mitochondrial-RNA-import protein PNPase, causes hereditary hearing loss.
22815474 2012 Nuclear EGFR suppresses ribonuclease activity of polynucleotide phosphorylase through DNAPK-mediated phosphorylation at serine 776.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
More...