Property Summary

NCBI Gene PubMed Count 44
PubMed Score 239.49
PubTator Score 102.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer 2.900 2.5e-02
invasive ductal carcinoma 1.200 5.8e-04
juvenile dermatomyositis 1.555 4.0e-11
nasopharyngeal carcinoma 1.200 3.1e-04
non-small cell lung cancer 1.355 5.0e-21
osteosarcoma 1.266 9.6e-03
ovarian cancer 2.200 1.7e-05
Pick disease -1.300 4.6e-05
progressive supranuclear palsy -1.500 4.9e-03

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (31)

AA Sequence

MAACRYCCSCLRLRPLSDGPFLLPRRDRALTQLQVRALWSSAGSRAVAVDLGNRKLEISSGKLARFADGS      1 - 70
AVVQSGDTAVMVTAVSKTKPSPSQFMPLVVDYRQKAAAAGRIPTNYLRREIGTSDKEILTSRIIDRSIRP     71 - 140
LFPAGYFYDTQVLCNLLAVDGVNEPDVLAINGASVALSLSDIPWNGPVGAVRIGIIDGEYVVNPTRKEMS    141 - 210
SSTLNLVVAGAPKSQIVMLEASAENILQQDFCHAIKVGVKYTQQIIQGIQQLVKETGVTKRTPQKLFTPS    211 - 280
PEIVKYTHKLAMERLYAVFTDYEHDKVSRDEAVNKIRLDTEEQLKEKFPEADPYEIIESFNVVAKEVFRS    281 - 350
IVLNEYKRCDGRDLTSLRNVSCEVDMFKTLHGSALFQRGQTQVLCTVTFDSLESGIKSDQVITAINGIKD    351 - 420
KNFMLHYEFPPYATNEIGKVTGLNRRELGHGALAEKALYPVIPRDFPFTIRVTSEVLESNGSSSMASACG    421 - 490
GSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIEDYNGDMDFKIAGTNKGITALQAD    491 - 560
IKLPGIPIKIVMEAIQQASVAKKEILQIMNKTISKPRASRKENGPVVETVQVPLSKRAKFVGPGGYNLKK    561 - 630
LQAETGVTISQVDEETFSVFAPTPSAMHEARDFITEICKDDQEQQLEFGAVYTATITEIRDTGVMVKLYP    631 - 700
NMTAVLLHNTQLDQRKIKHPTALGLEVGQEIQVKYFGRDPADGRMRLSRKVLQSPATTVVRTLNDRSSIV    701 - 770
MGEPISQSSSNSQ                                                             771 - 783
//

Text Mined References (50)

PMID Year Title