Property Summary

NCBI Gene PubMed Count 12
PubMed Score 118.24
PubTator Score 1215.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 4.54045735959348E-23
tuberculosis 1563 5.00985734090345E-8
primary Sjogren syndrome 789 1.86758564268152E-4
cutaneous lupus erythematosus 1056 0.00162830753699376
ovarian cancer 8492 0.0019263900377402
ulcerative colitis 2087 0.00204736329668114
head and neck cancer and chronic obstructive pulmonary disease 237 0.00255175468249212
osteosarcoma 7933 0.00385244940200454
Rheumatoid Arthritis 1171 0.00707566363676864
atypical teratoid / rhabdoid tumor 4369 0.0116908643344119
interstitial cystitis 2299 0.0130009351495193
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0152647856797991
gastric carcinoma 832 0.0167108592128738
mucosa-associated lymphoid tissue lymphoma 480 0.0225274469115578
sarcoidosis 368 0.0297781316453645
group 3 medulloblastoma 2254 0.0332094698926981
subependymal giant cell astrocytoma 2287 0.0379855514239005
medulloblastoma, large-cell 6234 0.0386249753211869

Expression

Synonym

Accession Q8TCQ1 D3DP29 Q9NWR0
Symbols RNF171
MARCH-I

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (6)

PMID Text
23264739 findings highlight the complex regulation of MARCH1 trafficking in the endocytic pathway as well as the intricate interactions between its cytoplasmic tails.
22508929 MARCH1 is capable of autoubiquitination, thus regulating its own expression.
21757542 expression of MARCH1 or MARCH8 causes a drastic change CD98 trafficking after endocytosis
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18389477 The immunosuppressive effect of IL-10 on antigen presentation is mediated through induced expression of MARCH1.
18305173 MARCH I is a major regulator of HLA-DR traffic, and its loss contributes to the acquisition of the potent immunostimulatory properties of mature human DCs.

AA Sequence

MLGWCEAIARNPHRIPNNTRTPEISGDLADASQTSTLNEKSPGRSASRSSNISKASSPTTGTAPRSQSRL      1 - 70
SVCPSTQDICRICHCEGDEESPLITPCRCTGTLRFVHQSCLHQWIKSSDTRCCELCKYDFIMETKLKPLR     71 - 140
KWEKLQMTTSERRKIFCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGNDNGVLEWPFWTKLVVVAIGFTG    141 - 210
GLVFMYVQCKVYVQLWRRLKAYNRVIFVQNCPDTAKKLEKNFSCNVNTDIKDAVVVPVPQTGANSLPSAE    211 - 280
GGPPEVVSV                                                                 281 - 289
//

Text Mined References (14)

PMID Year Title
24578125 2014 Common variants in UMOD associate with urinary uromodulin levels: a meta-analysis.
23264739 2013 Identification of a novel motif that affects the conformation and activity of the MARCH1 E3 ubiquitin ligase.
22508929 2012 Autoregulation of MARCH1 expression by dimerization and autoubiquitination.
21757542 2011 MARCH ubiquitin ligases alter the itinerary of clathrin-independent cargo from recycling to degradation.
21490949 2011 Transferability of type 2 diabetes implicated loci in multi-ethnic cohorts from Southeast Asia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19117940 2009 The HLA-DRalpha chain is modified by polyubiquitination.
18389477 2008 Interleukin-10-induced MARCH1 mediates intracellular sequestration of MHC class II in monocytes.
18305173 2008 MHC class II stabilization at the surface of human dendritic cells is the result of maturation-dependent MARCH I down-regulation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...