Property Summary

NCBI Gene PubMed Count 12
Grant Count 16
R01 Count 3
Funding $1,948,207
PubMed Score 118.24
PubTator Score 1215.77

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
23264739 findings highlight the complex regulation of MARCH1 trafficking in the endocytic pathway as well as the intricate interactions between its cytoplasmic tails.
22508929 MARCH1 is capable of autoubiquitination, thus regulating its own expression.
21757542 expression of MARCH1 or MARCH8 causes a drastic change CD98 trafficking after endocytosis
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18389477 The immunosuppressive effect of IL-10 on antigen presentation is mediated through induced expression of MARCH1.
18305173 MARCH I is a major regulator of HLA-DR traffic, and its loss contributes to the acquisition of the potent immunostimulatory properties of mature human DCs.

AA Sequence

MLGWCEAIARNPHRIPNNTRTPEISGDLADASQTSTLNEKSPGRSASRSSNISKASSPTTGTAPRSQSRL      1 - 70
SVCPSTQDICRICHCEGDEESPLITPCRCTGTLRFVHQSCLHQWIKSSDTRCCELCKYDFIMETKLKPLR     71 - 140
KWEKLQMTTSERRKIFCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGNDNGVLEWPFWTKLVVVAIGFTG    141 - 210
GLVFMYVQCKVYVQLWRRLKAYNRVIFVQNCPDTAKKLEKNFSCNVNTDIKDAVVVPVPQTGANSLPSAE    211 - 280
GGPPEVVSV                                                                 281 - 289
//

Text Mined References (14)

PMID Year Title
24578125 2014 Common variants in UMOD associate with urinary uromodulin levels: a meta-analysis.
23264739 2013 Identification of a novel motif that affects the conformation and activity of the MARCH1 E3 ubiquitin ligase.
22508929 2012 Autoregulation of MARCH1 expression by dimerization and autoubiquitination.
21757542 2011 MARCH ubiquitin ligases alter the itinerary of clathrin-independent cargo from recycling to degradation.
21490949 2011 Transferability of type 2 diabetes implicated loci in multi-ethnic cohorts from Southeast Asia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19117940 2009 The HLA-DRalpha chain is modified by polyubiquitination.
18389477 2008 Interleukin-10-induced MARCH1 mediates intracellular sequestration of MHC class II in monocytes.
18305173 2008 MHC class II stabilization at the surface of human dendritic cells is the result of maturation-dependent MARCH I down-regulation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...