Property Summary

NCBI Gene PubMed Count 13
PubMed Score 122.35
PubTator Score 1215.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (7)

AA Sequence

MLGWCEAIARNPHRIPNNTRTPEISGDLADASQTSTLNEKSPGRSASRSSNISKASSPTTGTAPRSQSRL      1 - 70
SVCPSTQDICRICHCEGDEESPLITPCRCTGTLRFVHQSCLHQWIKSSDTRCCELCKYDFIMETKLKPLR     71 - 140
KWEKLQMTTSERRKIFCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGNDNGVLEWPFWTKLVVVAIGFTG    141 - 210
GLVFMYVQCKVYVQLWRRLKAYNRVIFVQNCPDTAKKLEKNFSCNVNTDIKDAVVVPVPQTGANSLPSAE    211 - 280
GGPPEVVSV                                                                 281 - 289
//

Text Mined References (15)

PMID Year Title