Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
hepatocellular carcinoma 1.400 0.001
tuberculosis and treatment for 6 months -2.000 0.000
group 4 medulloblastoma 1.500 0.000
lung carcinoma 1.100 0.000

Synonym

Accession Q8TCP9 A4D293 A8K3V9 B2RD92 C9J6A8 D6W5T2 Q8N9P3
Symbols C7orf38

Gene

PANTHER Protein Class (1)

AA Sequence

MTPESRDTTDLSPGGTQEMEGIVIVKVEEEDEEDHFQKERNKVESSPQVLSRSTTMNERALLSSYLVAYR      1 - 70
VAKEKMAHTAAEKIILPACMDMVRTIFDDKSADKLRTIPLSDNTISRRICTIAKHLEAMLITRLQSGIDF     71 - 140
AIQLDESTDIASCPTLLVYVRYVWQDDFVEDLLCCLNLNSHITGLDLFTELENCLLGQYKLNWKHCKGIS    141 - 210
SDGTANMTGKHSRLTEKLLEATHNNAVWNHCFIHREALVSKEISPSLMDVLKNAVKTVNFIKGSSLNSRL    211 - 280
LEIFCSEIGVNHTHLLFHTEVRWLSQGKVLSRVYELRNEIYIFLVEKQSHLANIFEDDIWVTKLAYLSDI    281 - 350
FGILNELSLKMQGKNNDIFQYLEHILGFQKTLLLWQARLKSNRPSYYMFPTLLQHIEENIINEDCLKEIK    351 - 420
LEILLHLTSLSQTFNYYFPEEKFESLKENIWMKDPFAFQNPESIIELNLEPEEENELLQLSSSFTLKNYY    421 - 490
KILSLSAFWIKIKDDFPLLSRKSILLLLPFTTTYLCELGFSILTRLKTKKRNRLNSAPDMRVALSSCVPD    491 - 560
WKELMNRQAHPSH                                                             561 - 573
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16314882 Sequence diversity and haplotype structure at the human CYP3A cluster.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10607616 1999 Interspersed repeats and other mementos of transposable elements in mammalian genomes.