Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 3.7e-13
group 4 medulloblastoma 1855 2.5e-05
tuberculosis 2010 1.4e-04
hepatocellular carcinoma 547 1.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (4)

Disease log2 FC p
group 4 medulloblastoma 1.500 2.5e-05
hepatocellular carcinoma 1.400 1.5e-03
lung carcinoma 1.100 3.7e-13
tuberculosis -1.600 1.4e-04

Synonym

Accession Q8TCP9 A4D293 A8K3V9 B2RD92 C9J6A8 D6W5T2 Q8N9P3
Symbols C7orf38

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MTPESRDTTDLSPGGTQEMEGIVIVKVEEEDEEDHFQKERNKVESSPQVLSRSTTMNERALLSSYLVAYR      1 - 70
VAKEKMAHTAAEKIILPACMDMVRTIFDDKSADKLRTIPLSDNTISRRICTIAKHLEAMLITRLQSGIDF     71 - 140
AIQLDESTDIASCPTLLVYVRYVWQDDFVEDLLCCLNLNSHITGLDLFTELENCLLGQYKLNWKHCKGIS    141 - 210
SDGTANMTGKHSRLTEKLLEATHNNAVWNHCFIHREALVSKEISPSLMDVLKNAVKTVNFIKGSSLNSRL    211 - 280
LEIFCSEIGVNHTHLLFHTEVRWLSQGKVLSRVYELRNEIYIFLVEKQSHLANIFEDDIWVTKLAYLSDI    281 - 350
FGILNELSLKMQGKNNDIFQYLEHILGFQKTLLLWQARLKSNRPSYYMFPTLLQHIEENIINEDCLKEIK    351 - 420
LEILLHLTSLSQTFNYYFPEEKFESLKENIWMKDPFAFQNPESIIELNLEPEEENELLQLSSSFTLKNYY    421 - 490
KILSLSAFWIKIKDDFPLLSRKSILLLLPFTTTYLCELGFSILTRLKTKKRNRLNSAPDMRVALSSCVPD    491 - 560
WKELMNRQAHPSH                                                             561 - 573
//

Text Mined References (9)

PMID Year Title