Property Summary

NCBI Gene PubMed Count 18
Grant Count 14
R01 Count 14
Funding $1,404,558.89
PubMed Score 8.49
PubTator Score 9.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.426 0.024
ovarian cancer -2.200 0.000

Gene RIF (7)

PMID Text
25029371 Post-translational modification of cotranslationally skipped sites by STT3B is hindered by the middle X residue, resulting in hypoglycosylation of consensus sites containing large hydrophobic and negatively charged side chains.
23842455 Results show homozygous mutation in STT3A and in STT3B causes congenital disorders of glycosylation.
23530066 Extreme C-terminal sites are posttranslocationally glycosylated by the STT3B isoform of the OST.
22607976 Data show that prolonged transthyretin (TTR) unfolding induces externalization of cryptic N-glycosylation site and triggers STT3B-dependent posttranslational N-glycosylation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19167329 The STT3B isoform is required for efficient cotranslational glycosylation of an acceptor site adjacent to the N-terminal signal sequence of a secreted protein.
12887896 STT3 proteins are the catalytic subunits of the oligosaccharyltransferase. Vertebrate, plant and insect genomes have an STT3A gene and a STT3B gene. SIMP is a member of the STT3B subfamily of STT3 proteins.

AA Sequence

MAEPSAPESKHKSSLNSSPWSGLMALGNSRHGHHGPGAQCAHKAAGGAAPPKPAPAGLSGGLSQPAGWQS      1 - 70
LLSFTILFLAWLAGFSSRLFAVIRFESIIHEFDPWFNYRSTHHLASHGFYEFLNWFDERAWYPLGRIVGG     71 - 140
TVYPGLMITAGLIHWILNTLNITVHIRDVCVFLAPTFSGLTSISTFLLTRELWNQGAGLLAACFIAIVPG    141 - 210
YISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWTMCCCLSYFYMVSAWGGYVFIINLIPLHVFVL    211 - 280
LLMQRYSKRVYIAYSTFYIVGLILSMQIPFVGFQPIRTSEHMAAAGVFALLQAYAFLQYLRDRLTKQEFQ    281 - 350
TLFFLGVSLAAGAVFLSVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHI    351 - 420
LVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAIAFSNVFEHYLGDDMKR    421 - 490
ENPPVEDSSDEDDKRNQGNLYDKAGKVRKHATEQEKTEEGLGPNIKSIVTMLMLMLLMMFAVHCTWVTSN    491 - 560
AYSSPSVVLASYNHDGTRNILDDFREAYFWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSH    561 - 630
IALVGKAMSSNETAAYKIMRTLDVDYVLVIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYFTPQG    631 - 700
EFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLVRIY    701 - 770
KVKAPDNRETLDHKPRVTNIFPKQKYLSKKTTKRKRGYIKNKLVFKKGKKISKKTV                  771 - 826
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25029371 2014 The middle X residue influences cotranslational N-glycosylation consensus site skipping.
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
23842455 2013 Mutations in STT3A and STT3B cause two congenital disorders of glycosylation.
23530066 2013 Extreme C-terminal sites are posttranslocationally glycosylated by the STT3B isoform of the OST.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22607976 2012 STT3B-dependent posttranslational N-glycosylation as a surveillance system for secretory protein.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...