Property Summary

NCBI Gene PubMed Count 4
Grant Count 32
R01 Count 16
Funding $2,177,099.6
PubMed Score 22.52
PubTator Score 74.17

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MCFSRADAADNYPFGTCQQRKLFPHFHPPNLIGNKFVPLRGSPHRGPGCYFSDGYGLAYDLSKIPTSIKG      1 - 70
YTLGARTAVRFKPIQKEMTPHAGRYQKVSPQQEKHKQNFAPFNVLVPRFKNYPKDTYYPSPGAYNPEKKP     71 - 140
PPKIAWPMKFGSPDWAQVPCLQKRTLKAELSTDKDFRKHRNRVAYLSLYYN                       141 - 191
//

Text Mined References (7)

PMID Year Title
20643351 2010 Pitchfork regulates primary cilia disassembly and left-right asymmetry.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.