Knowledge Summary

Patent

No data available

Synonym

Accession Q8TCH9
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MPSTEGFGGLDRLVLPPPPQVLPLLSPARGRIQFSGRKSTGSWVTQMENLLLAQPLPDDCEILCGWRSLL      1 - 70
HLTFLIGFAPHFPHWFCNHHCHQHPPSHLTEVLQSSGELAHQLAPSRCSMRAEGTHRG                 71 - 128
//

Text Mined References (2)

PMID Year Title