Property Summary

NCBI Gene PubMed Count 25
PubMed Score 57.12
PubTator Score 18.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.300 3.3e-04
ependymoma -1.100 7.4e-04
glioblastoma -1.400 2.0e-03
lung carcinoma 1.900 4.1e-37
medulloblastoma, large-cell -1.900 8.2e-04
Pick disease -1.200 1.2e-04

Gene RIF (14)

AA Sequence

MAEAHQAVGFRPSLTSDGAEVELSAPVLQEIYLSGLRSWKRHLSRFWNDFLTGVFPASPLSWLFLFSAIQ      1 - 70
LAWFLQLDPSLGLMEKIKELLPDWGGQHHGLRGVLAAALFASCLWGALIFTLHVALRLLLSYHGWLLEPH     71 - 140
GAMSSPTKTWLALVRIFSGRHPMLFSYQRSLPRQPVPSVQDTVRKYLESVRPILSDEDFDWTAVLAQEFL    141 - 210
RLQASLLQWYLRLKSWWASNYVSDWWEEFVYLRSRNPLMVNSNYYMMDFLYVTPTPLQAARAGNAVHALL    211 - 280
LYRHRLNRQEIPPTLLMGMRPLCSAQYEKIFNTTRIPGVQKDYIRHLHDSQHVAVFHRGRFFRMGTHSRN    281 - 350
SLLSPRALEQQFQRILDDPSPACPHEEHLAALTAAPRGTWAQVRTSLKTQAAEALEAVEGAAFFVSLDAE    351 - 420
PAGLTREDPAASLDAYAHALLAGRGHDRWFDKSFTLIVFSNGKLGLSVEHSWADCPISGHMWEFTLATEC    421 - 490
FQLGYSTDGHCKGHPDPTLPQPQRLQWDLPDQIHSSISLALRGAKILSENVDCHVVPFSLFGKSFIRRCH    491 - 560
LSSDSFIQIALQLAHFRDRGQFCLTYESAMTRLFLEGRTETVRSCTREACNFVRAMEDKEKTDPQCLALF    561 - 630
RVAVDKHQALLKAAMSGQGVDRHLFALYIVSRFLHLQSPFLTQVHSEQWQLSTSQIPVQQMHLFDVHNYP    631 - 700
DYVSSGGGFGPADDHGYGVSYIFMGDGMITFHISSKKSSTKTDSHRLGQHIEDALLDVASLFQAGQHFKR    701 - 770
RFRGSGKENSRHRCGFLSRQTGASKASMTSTDF                                         771 - 803
//

Text Mined References (26)

PMID Year Title