Property Summary

NCBI Gene PubMed Count 23
Grant Count 6
R01 Count 5
Funding $523,116.85
PubMed Score 49.81
PubTator Score 18.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
posterior fossa group B ependymoma -1.400 0.000
glioblastoma -1.400 0.002
medulloblastoma, large-cell -1.900 0.001
adult high grade glioma -1.300 0.000
lung carcinoma 1.900 0.000
Pick disease -1.200 0.000

Synonym

Accession Q8TCG5 A8K0Z8 Q5K6N5 Q8N6Q9 Q8NDS6 Q8TE84 CPT1-B
Symbols CATL1
CPT1P
CPTIC
SPG73
CPT1-B
CPTI-B

Gene

PANTHER Protein Class (2)

PDB

2M76  

Gene RIF (12)

PMID Text
26041663 CPT1c is found in brain regions that are related to food intake and neuropsychiatric disease. CPT1c affects ceramide levels, endocannabionoids, and oxidative processes and may play an important role in various brain functions such as learning.
25751282 CPT1C mutation associated with novel form of pure autosomal dominant hereditary spastic paraplegia.
25505242 The interaction of HIV-1 CA with human cellular carnitine palmitoyltransferase 1C protein (CPT1C) is identified by yeast two-hybrid screen
24618825 High grade glioblastoma is associated with increased level of ZFP57, a protein involved in gene imprinting, and aberrant expression of CPT1A and CPT1C.
21961029 Data suggest that an involvement of CPT1C in cellular energy-sensing pathways and provide evidence for a role of CPT1C in hypothalamic regulation of energy homeostasis.
21576264 cells can use a novel mechanism involving CPT1C and fatty acid metabolism to protect against metabolic stress
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18385088 Accumulation of 3-hydroxylated intermediates of long-chain fatty acids may contribute to the pathogenesis of retinopathy in MTP deficiencies.
More...

AA Sequence

MAEAHQAVGFRPSLTSDGAEVELSAPVLQEIYLSGLRSWKRHLSRFWNDFLTGVFPASPLSWLFLFSAIQ      1 - 70
LAWFLQLDPSLGLMEKIKELLPDWGGQHHGLRGVLAAALFASCLWGALIFTLHVALRLLLSYHGWLLEPH     71 - 140
GAMSSPTKTWLALVRIFSGRHPMLFSYQRSLPRQPVPSVQDTVRKYLESVRPILSDEDFDWTAVLAQEFL    141 - 210
RLQASLLQWYLRLKSWWASNYVSDWWEEFVYLRSRNPLMVNSNYYMMDFLYVTPTPLQAARAGNAVHALL    211 - 280
LYRHRLNRQEIPPTLLMGMRPLCSAQYEKIFNTTRIPGVQKDYIRHLHDSQHVAVFHRGRFFRMGTHSRN    281 - 350
SLLSPRALEQQFQRILDDPSPACPHEEHLAALTAAPRGTWAQVRTSLKTQAAEALEAVEGAAFFVSLDAE    351 - 420
PAGLTREDPAASLDAYAHALLAGRGHDRWFDKSFTLIVFSNGKLGLSVEHSWADCPISGHMWEFTLATEC    421 - 490
FQLGYSTDGHCKGHPDPTLPQPQRLQWDLPDQIHSSISLALRGAKILSENVDCHVVPFSLFGKSFIRRCH    491 - 560
LSSDSFIQIALQLAHFRDRGQFCLTYESAMTRLFLEGRTETVRSCTREACNFVRAMEDKEKTDPQCLALF    561 - 630
RVAVDKHQALLKAAMSGQGVDRHLFALYIVSRFLHLQSPFLTQVHSEQWQLSTSQIPVQQMHLFDVHNYP    631 - 700
DYVSSGGGFGPADDHGYGVSYIFMGDGMITFHISSKKSSTKTDSHRLGQHIEDALLDVASLFQAGQHFKR    701 - 770
RFRGSGKENSRHRCGFLSRQTGASKASMTSTDF                                         771 - 803
//

Text Mined References (24)

PMID Year Title
26041663 2015 The Carnitine Palmitoyl Transferase (CPT) System and Possible Relevance for Neuropsychiatric and Neurological Conditions.
25751282 2015 Mutation in CPT1C Associated With Pure Autosomal Dominant Spastic Paraplegia.
24618825 2014 High grade glioblastoma is associated with aberrant expression of ZFP57, a protein involved in gene imprinting, and of CPT1A and CPT1C that regulate fatty acid metabolism.
21961029 2011 The CPT1C 5'UTR contains a repressing upstream open reading frame that is regulated by cellular energy availability and AMPK.
21576264 2011 Carnitine palmitoyltransferase 1C promotes cell survival and tumor growth under conditions of metabolic stress.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20864405 2010 Mechanisms of peripheral neuropathy associated with bortezomib and vincristine in patients with newly diagnosed multiple myeloma: a prospective analysis of data from the HOVON-65/GMMG-HD4 trial.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19694967 2010 Regulatory enzymes of mitochondrial beta-oxidation as targets for treatment of the metabolic syndrome.
More...