Property Summary

NCBI Gene PubMed Count 16
Grant Count 1
Funding $19,580.67
PubMed Score 1.83
PubTator Score 9.68

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8TCG2 Q9NUW2
Symbols PIK42B
PI4KIIB

Gene

PANTHER Protein Class (2)

 Grant Application (1)

PDB

4WTV  

Gene RIF (10)

PMID Text
26143926 Here two crystal structures are presented: the structure of human PIK42A and the structure of PIK42B containing a nucleoside analogue.
24972704 Results provide evidence that type II PtdIns 4-kinase b was indeed recruited to CD4- p56lck complex upon CD4 receptor cross linking, suggests a mechanism for its association and a role for it in CD4-mediated intracellular calcium release.
24481753 Canonical tyrosine residues mutation in FcepsilonRIgamma ITAM (Y65 and Y76) reveals that these two tyrosine residues in gamma subunit are required for its interaction with type II PtdIns 4-kinases.
23619705 type II PtdIns 4-kinase beta is a key component in early T cell activation signaling cascades
20583997 PIP4Kbeta interacts with and modulates nuclear localization of the PIP4Kalpha.
19539307 There is no evidence to suggest that PI4K2B is contributing to bipolar disorder in this family but a role for this gene in schizophrenia has not been excluded.
19539307 Observational study of gene-disease association. (HuGE Navigator)
18316730 LB-PI4K2B-1S-specific CD4(+) T cells contributed to the antitumor response by both directly eliminating malignant cells as effector cells and stimulating CD8(+) T cell immunity as helper cells.
16949365 UV irradiation increases nuclear PtdIns5P levels via inhibition of the activity of the beta isoform of PtdIns5P 4-kinase (PIP4Kbeta), an enzyme that can phosphorylate and remove PtdIns5P.
16337488 Type II PtdIns 4-kinase beta interacts with TCR-CD3 zeta chain. The C-terminal ITAM is critical for enzyme docking on the zeta chain. The association is tyrosyl phosphorylation dependent. Mutation of Y-151 & Y-142 disrupts interaction of the 2 proteins.

AA Sequence

MEDPSEPDRLASADGGSPEEEEDGEREPLLPRIAWAHPRRGAPGSAVRLLDAAGEEGEAGDEELPLPPGD      1 - 70
VGVSRSSSAELDRSRPAVSVTIGTSEMNAFLDDPEFADIMLRAEQAIEVGIFPERISQGSSGSYFVKDPK     71 - 140
RKIIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLIPNQGYLSEAGAYLVDNKLHLSIVPKTKVV    141 - 210
WLVSETFNYNAIDRAKSRGKKYALEKVPKVGRKFHRIGLPPKIGSFQLFVEGYKEAEYWLRKFEADPLPE    211 - 280
NIRKQFQSQFERLVILDYIIRNTDRGNDNWLVRYEKQKCEKEIDHKESKWIDDEEFLIKIAAIDNGLAFP    281 - 350
FKHPDEWRAYPFHWAWLPQAKVPFSEEIRNLILPYISDMNFVQDLCEDLYELFKTDKGFDKATFESQMSV    351 - 420
MRGQILNLTQALRDGKSPFQLVQIPCVIVERSQGGSQGRIVHLSNSFTQTVNCRKPFFSSW             421 - 481
//

Text Mined References (20)

PMID Year Title
26143926 2015 The high-resolution crystal structure of phosphatidylinositol 4-kinase II? and the crystal structure of phosphatidylinositol 4-kinase II? containing a nucleoside analogue provide a structural basis for isoform-specific inhibitor design.
24972704 2014 Type II PtdIns 4-kinase ? associates with CD4-p56lck complex and is involved in CD4 receptor signaling.
24481753 2014 Type II phosphatidylinositol 4-kinases interact with Fc?RI? subunit in RBL-2H3 cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23619705 2013 Type II phosphatidylinositol 4-kinase ? is an integral signaling component of early T cell activation mechanisms.
20583997 2010 PIP4Kbeta interacts with and modulates nuclear localization of the high-activity PtdIns5P-4-kinase isoform PIP4Kalpha.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19539307 2009 A case-control association study and family-based expression analysis of the bipolar disorder candidate gene PI4K2B.
19369195 2009 Large-scale proteomics analysis of the human kinome.
More...