Property Summary

NCBI Gene PubMed Count 93
PubMed Score 103.99
PubTator Score 238.42

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8TCG1 A1L4J7 B9EGC3 Q6P4G6 Q8WVP8 Q96PI2 Q9H9C6 Q9P204
Symbols p90
CIP2A

Gene

Gene RIF (82)

PMID Text
26823836 patients with a stronger expression of CIP2A in tgastric umor tissues had no significant relationship with these genes that are related to gastric cancer chemotherapy drug resistance
26813457 CIP2A levels were significantly associated with the American Joint Committee on Cancer (AJCC) stage, histological grade and lymph node metastasis in breast cancer patients.
26560124 CIP2A is a tumor-associated autoantigen in lung cancer, which promote lung cancer proliferation partially through MKK4/7-JNK signaling pathway.
26522733 CIP2A was detected in tongue cancer and tongue hyperplasia, whereas local inflammation was stronger in cancer, CIP2A expression was increased in metastasized cancer compared to non-metastasized
26327467 CIP2A is a critical oncoprotein involved in cell invasion and epithelial mesenchymal transition in clear cell renal carcinoma.
26234767 Alterations affecting PP2A subunits together with the deregulation of endogenous PP2A inhibitors such as CIP2A and SET have been described as contributing mechanisms to inactivate PP2A in prostate cancer.
25965834 Identify CIP2A as a common denominator for androgen receptor-signaling and prostate cancer stem cell functionality, and suggest as possible therapeutic target.
25896895 CIP2A is an independent prognostic marker in patients with wild-type KRAS metastatic colorectal cancer after colorectal liver metastasectomy.
25833693 we provide a novel therapeutic mechanism for inhibiting CIP2A function in cancerous cells via targeting the CIP2A-LRRC59 interaction.
25765543 High cancerous inhibitor of PP2A (CIP2A) protein levels at diagnosis of chronic myeloid leukaemia are associated with disease progression in imatinib-treated patients
More...

AA Sequence

MDSTACLKSLLLTVSQYKAVKSEANATQLLRHLEVISGQKLTRLFTSNQILTSECLSCLVELLEDPNISA      1 - 70
SLILSIIGLLSQLAVDIETRDCLQNTYNLNSVLAGVVCRSSHTDSVFLQCIQLLQKLTYNVKIFYSGANI     71 - 140
DELITFLIDHIQSSEDELKMPCLGLLANLCRHNLSVQTHIKTLSNVKSFYRTLITLLAHSSLTVVVFALS    141 - 210
ILSSLTLNEEVGEKLFHARNIHQTFQLIFNILINGDGTLTRKYSVDLLMDLLKNPKIADYLTRYEHFSSC    211 - 280
LHQVLGLLNGKDPDSSSKVLELLLAFCSVTQLRHMLTQMMFEQSPPGSATLGSHTKCLEPTVALLRWLSQ    281 - 350
PLDGSENCSVLALELFKEIFEDVIDAANCSSADRFVTLLLPTILDQLQFTEQNLDEALTRKKCERIAKAI    351 - 420
EVLLTLCGDDTLKMHIAKILTTVKCTTLIEQQFTYGKIDLGFGTKVADSELCKLAADVILKTLDLINKLK    421 - 490
PLVPGMEVSFYKILQDPRLITPLAFALTSDNREQVQSGLRILLEAAPLPDFPALVLGESIAANNAYRQQE    491 - 560
TEHIPRKMPWQSSNHSFPTSIKCLTPHLKDGVPGLNIEELIEKLQSGMVVKDQICDVRISDIMDVYEMKL    561 - 630
STLASKESRLQDLLETKALALAQADRLIAQHRCQRTQAETEARTLASMLREVERKNEELSVLLKAQQVES    631 - 700
ERAQSDIEHLFQHNRKLESVAEEHEILTKSYMELLQRNESTEKKNKDLQITCDSLNKQIETVKKLNESLK    701 - 770
EQNEKSIAQLIEKEEQRKEVQNQLVDREHKLANLHQKTKVQEEKIKTLQKEREDKEETIDILRKELSRTE    771 - 840
QIRKELSIKASSLEVQKAQLEGRLEEKESLVKLQQEELNKHSHMIAMIHSLSGGKINPETVNLSI         841 - 905
//

Text Mined References (101)

PMID Year Title
26823836 2015 Relationship between CIP2A expression, and prognosis and MDR-related proteins in patients with advanced gastric cancer.
26813457 2016 Clinical significance of sCIP2A levels in breast cancer.
26560124 2015 CIP2A overexpression induces autoimmune response and enhances JNK signaling pathway in human lung cancer.
26522733 2015 The association and prognostic relevance of cancerous inhibitor of protein phosphatase 2A and inflammation in tongue squamous cell carcinoma.
26327467 2015 Overexpression of CIP2A in clear cell renal cell carcinoma promotes cellular epithelial-mesenchymal transition and is associated with poor prognosis.
26234767 2015 PP2A inhibition as a novel therapeutic target in castration-resistant prostate cancer.
25965834 2015 CIP2A is a candidate therapeutic target in clinically challenging prostate cancer cell populations.
25896895 2015 Cancerous inhibitor of protein phosphatase 2A (CIP2A) is an independent prognostic marker in wild-type KRAS metastatic colorectal cancer after colorectal liver metastasectomy.
25833693 2015 Leucine-rich repeat-containing protein 59 mediates nuclear import of cancerous inhibitor of PP2A in prostate cancer cells.
25765543 2015 Second generation tyrosine kinase inhibitors prevent disease progression in high-risk (high CIP2A) chronic myeloid leukaemia patients.
More...