Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.25
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 1.66412732716256E-5
atypical teratoid / rhabdoid tumor 4369 2.37267265040223E-5
glioblastoma 5572 4.566990441364E-5
Multiple myeloma 1328 0.00136062985413809
diabetes mellitus 1663 0.00159704430452075
astrocytoma 1493 0.00202812215632254
group 4 medulloblastoma 1875 0.0058339087999296
subependymal giant cell astrocytoma 2287 0.037496023631924

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.747 0.001
astrocytoma -1.200 0.002
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.200 0.000
diabetes mellitus -1.100 0.002
group 4 medulloblastoma -1.100 0.006
subependymal giant cell astrocytoma -1.876 0.037
ovarian cancer -2.000 0.000

Synonym

Gene

  Ortholog (12)

 GO Function (1)

 Compartment GO Term (2)

AA Sequence

MAELDIGQHCQVEHCRQRDFLPFVCDDCSGIFCLEHRSRESHGCPEVTVINERLKTDQHTSYPCSFKDCA      1 - 70
ERELVAVICPYCEKNFCLRHRHQSDHECEKLEIPKPRMAATQKLVKDIIDSKTGETASKRWKGAKNSETA     71 - 140
AKVALMKLKMHADGDKSLPQTERIYFQVFLPKGSKEKSKPMFFCHRWSIGKAIDFAASLARLKNDNNKFT    141 - 210
AKKLRLCHITSGEALPLDHTLETWIAKEDCPLYNGGNIILEYLNDEEQFCKNVESYLE                211 - 268
//

Text Mined References (11)

PMID Year Title
24121501 2013 A conserved protein with AN1 zinc finger and ubiquitin-like domains modulates Cdc48 (p97) function in the ubiquitin-proteasome pathway.
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
21269460 2011 Initial characterization of the human central proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
More...