Property Summary

NCBI Gene PubMed Count 10
Grant Count 1
Funding $56,625
PubMed Score 10.97
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Spontaneous abortion 108
ovarian cancer 8,484

Gene RIF (4)

PMID Text
19023099 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)
16831268 CIC-2 siRNA could inhibit the cell proliferation of a human glioma cell line U-87.
11997112 cloning and expression in placenta - base sequence and amino acid sequences are given

AA Sequence

MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFG      1 - 70
IWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD      71 - 139
//

Text Mined References (12)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
19497882 2009 A primate subfamily of galectins expressed at the maternal-fetal interface that promote immune cell death.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16831268 2006 [siRNA-mediated silencing of ClC-2 gene inhibits proliferation of human U-87 glioma cells].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...