Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.97
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Spontaneous abortion 108
Disease Target Count P-value
ovarian cancer 8492 2.76456249409924E-5

Synonym

Accession Q8TCE9 A8MPV8 B2R530 C5HZ19 Q7Z4X8 Q96KD4 Q96KD5 Q96KD6 Q9NR03
Symbols CLC2
PPL13

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source
Macaque EggNOG Inparanoid

Gene RIF (4)

PMID Text
19023099 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)
16831268 CIC-2 siRNA could inhibit the cell proliferation of a human glioma cell line U-87.
11997112 cloning and expression in placenta - base sequence and amino acid sequences are given

AA Sequence

MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFG      1 - 70
IWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD      71 - 139
//

Text Mined References (12)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
19497882 2009 A primate subfamily of galectins expressed at the maternal-fetal interface that promote immune cell death.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16831268 2006 [siRNA-mediated silencing of ClC-2 gene inhibits proliferation of human U-87 glioma cells].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...