Property Summary

NCBI Gene PubMed Count 8
PubMed Score 27.43
PubTator Score 4.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (1)

AA Sequence

MKILLVFDFDNTIIDDNSDTWIVQCAPNKKLPIELRDSYRKGFWTEFMGRVFKYLGDKGVREHEMKRAVT      1 - 70
SLPFTPGMVELFNFIRKNKDKFDCIIISDSNSVFIDWVLEAASFHDIFDKVFTNPAAFNSNGHLTVENYH     71 - 140
THSCNRCPKNLCKKVVLIEFVDKQLQQGVNYTQIVYIGDGGNDVCPVTFLKNDDVAMPRKGYTLQKTLSR    141 - 210
MSQNLEPMEYSVVVWSSGVDIISHLQFLIKD                                           211 - 241
//

Text Mined References (9)

PMID Year Title