Property Summary

NCBI Gene PubMed Count 18
Grant Count 42
R01 Count 17
Funding $3,361,303.47
PubMed Score 403.42
PubTator Score 131.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.500 0.000
primitive neuroectodermal tumor 1.100 0.013

Gene RIF (3)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
12714505 Mutation analysis in the P5N-I gene led to the identification of 3 novel mutations
12418222 Data show that PN-I shows a higher affinity for oxynucleosides rather than deoxynucleosides, while the opposite is true for PN-II.

AA Sequence

MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGF      1 - 70
FLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGD     71 - 140
LLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE             141 - 201
//

Text Mined References (24)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17985935 2007 Crystal structures of human and murine deoxyribonucleotidases: insights into recognition of substrates and nucleotide analogues.
More...