Property Summary

NCBI Gene PubMed Count 18
PubMed Score 433.70
PubTator Score 131.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.500 7.0e-05
primitive neuroectodermal tumor 1.100 1.3e-02

Protein-protein Interaction (2)

Gene RIF (3)

AA Sequence

MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGF      1 - 70
FLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGD     71 - 140
LLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE             141 - 201
//

Text Mined References (24)

PMID Year Title