Property Summary

NCBI Gene PubMed Count 41
Grant Count 58
R01 Count 51
Funding $5,122,927.06
PubMed Score 235.28
PubTator Score 122.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
nephrosclerosis -2.166 0.005
osteosarcoma 1.514 0.000

Synonym

Accession Q8TCC7 B4DPH7 F5GWA8 F5H5J1 O95820 Q59EW9 Q96TC1
Symbols OAT3

Gene

 GWAS Trait (1)

Gene RIF (30)

PMID Text
26277839 The putative promoter sequences from hOAT1 (SLC22A6) and hOAT3 (SCL22A8) were cloned into a reporter plasmid.
25477469 The high efficacy of bendamustine in treating chronic lymphocytic leukemia might be partly due to the expression of OAT3 in lymphoma cells and the high affinity of bendamustine for this transporter.
25239859 PPIs inhibit [(3)H]MTX transport via hOAT3 inhibition.
24185403 high capacity p-cresyl sulfate trasnporter
24042472 Pemetrexed is a superior substrate to methotrexate for hOAT3.
23832370 transport of xanthurenic acid by OAT1 and OAT3
23649425 In HEK293-Flp-In cells, the OAT3-Ile305Phe variant had a lower maximum cefotaxime transport activity, Vmax , [159 +/- 3 nmol*(mg protein)(-1) /min (mean +/- SD)] compared with the reference OAT3 [305 +/- 28 nmol*(mg protein)(-1) /min, (mean +/- SD), p < 0.01].
23630107 The results confirmed that OAT1, OAT3, OCT2, MATE1, and MATE2-K were coexpressed in tubular epithelial cells.
22108572 Both hOAT1 and hOAT3 markedly stimulated the uptake of kynurenic acid into oocytes.
21945944 High urine OAT1, OAT3 and OAT4 is associated with severe acute kidney injury.
More...

AA Sequence

MTFSEILDRVGSMGHFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPHNASTGPWVLPMGPNGKP      1 - 70
ERCLRFVHPPNASLPNDTQRAMEPCLDGWVYNSTKDSIVTEWDLVCNSNKLKEMAQSIFMAGILIGGLVL     71 - 140
GDLSDRFGRRPILTCSYLLLAASGSGAAFSPTFPIYMVFRFLCGFGISGITLSTVILNVEWVPTRMRAIM    141 - 210
STALGYCYTFGQFILPGLAYAIPQWRWLQLTVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVA    211 - 280
VFNGKKEEGERLSLEELKLNLQKEISLAKAKYTASDLFRIPMLRRMTFCLSLAWFATGFAYYSLAMGVEE    281 - 350
FGVNLYILQIIFGGVDVPAKFITILSLSYLGRHTTQAAALLLAGGAILALTFVPLDLQTVRTVLAVFGKG    351 - 420
CLSSSFSCLFLYTSELYPTVIRQTGMGVSNLWTRVGSMVSPLVKITGEVQPFIPNIIYGITALLGGSAAL    421 - 490
FLPETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLGSS                      491 - 542
//

Text Mined References (43)

PMID Year Title
26277839 2015 Regulation of Expression of Renal Organic Anion Transporters OAT1 and OAT3 in a Model of Ischemia/Reperfusion Injury.
25477469 2015 Renal human organic anion transporter 3 increases the susceptibility of lymphoma cells to bendamustine uptake.
25239859 2014 Proton pump inhibitors inhibit methotrexate transport by renal basolateral organic anion transporter hOAT3.
24185403 2014 Human organic anion transporters function as a high-capacity transporter for p-cresyl sulfate, a uremic toxin.
24042472 2014 Characteristics of pemetrexed transport by renal basolateral organic anion transporter hOAT3.
23832370 2013 Transport of xanthurenic acid by rat/human organic anion transporters OAT1 and OAT3.
23649425 2013 Reduced renal clearance of cefotaxime in asians with a low-frequency polymorphism of OAT3 (SLC22A8).
23630107 2013 Precise comparison of protein localization among OCT, OAT, and MATE in human kidney.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22108572 2012 Interaction and transport of kynurenic acid via human organic anion transporters hOAT1 and hOAT3.
More...