Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.05
PubTator Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 1.3e-04
glioblastoma 1.300 4.3e-02
group 4 medulloblastoma 1.200 3.2e-03
medulloblastoma, large-cell 2.900 4.7e-05
nasopharyngeal carcinoma 1.100 1.8e-03
non-small cell lung cancer 1.050 7.9e-14
osteosarcoma 3.250 3.4e-05
ovarian cancer -1.100 3.7e-04
pediatric high grade glioma 1.200 1.5e-02

Gene RIF (1)

AA Sequence

MAGILRLVVQWPPGRLQTVTKGVESLICTDWIRHKFTRSRIPEKVFQASPEDHEKYGGDPQNPHKLHIVT      1 - 70
RIKSTRRRPYWEKDIIKMLGLEKAHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPAEENMSNTCLK     71 - 140
STGELVVQWHLKPVEQKAHES                                                     141 - 161
//

Text Mined References (17)

PMID Year Title