Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.63
PubTator Score 2.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Gout 104 0.0 1.0

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus -1.300 1.0e-03
medulloblastoma, large-cell -1.200 2.8e-03
osteosarcoma -1.902 1.1e-04
ovarian cancer 1.500 7.2e-07
tuberculosis and treatment for 6 months -1.200 1.7e-04

Synonym

Accession Q8TCB7 Q96LU4
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEEL      1 - 70
RSCREFEDQKLTMLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVKQNPLYDTERCKVFQCDLTKD     71 - 140
DLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLKPGKSVLFRDYGLYDHAMLRFKASSKLGENF    141 - 210
YVRQDGTRSYFFTDDFLAQLFMDTGYEEVVNEYVFRETVNKKEGLCVPRVFLQSKFLKPPKNPSPVVLGL    211 - 280
DPKS                                                                      281 - 284
//

Text Mined References (9)

PMID Year Title