Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.29
PubTator Score 2.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.902 0.000
medulloblastoma, large-cell -1.200 0.003
tuberculosis and treatment for 6 months -1.200 0.000
diabetes mellitus -1.300 0.001
ovarian cancer 1.500 0.000

AA Sequence

MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEEL      1 - 70
RSCREFEDQKLTMLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVKQNPLYDTERCKVFQCDLTKD     71 - 140
DLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLKPGKSVLFRDYGLYDHAMLRFKASSKLGENF    141 - 210
YVRQDGTRSYFFTDDFLAQLFMDTGYEEVVNEYVFRETVNKKEGLCVPRVFLQSKFLKPPKNPSPVVLGL    211 - 280
DPKS                                                                      281 - 284
//

Text Mined References (8)

PMID Year Title
26888608 2016 A tRNA methyltransferase paralog is important for ribosome stability and cell division in Trypanosoma brucei.
18759275 2008 Association of a common nonsynonymous variant in GLUT9 with serum uric acid levels in old order amish.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.