Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.29
PubTator Score 2.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Mammary Neoplasms 410
Disease Target Count P-value
ovarian cancer 8492 7.15276254377607E-7
osteosarcoma 7933 1.08124712544134E-4
tuberculosis and treatment for 6 months 686 1.71662634515187E-4
diabetes mellitus 1663 0.00104821351867176
medulloblastoma, large-cell 6234 0.00281714476224782

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.902 0.000
medulloblastoma, large-cell -1.200 0.003
tuberculosis and treatment for 6 months -1.200 0.000
diabetes mellitus -1.300 0.001
ovarian cancer 1.500 0.000

Synonym

Accession Q8TCB7 Q96LU4
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

AA Sequence

MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEEL      1 - 70
RSCREFEDQKLTMLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVKQNPLYDTERCKVFQCDLTKD     71 - 140
DLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLKPGKSVLFRDYGLYDHAMLRFKASSKLGENF    141 - 210
YVRQDGTRSYFFTDDFLAQLFMDTGYEEVVNEYVFRETVNKKEGLCVPRVFLQSKFLKPPKNPSPVVLGL    211 - 280
DPKS                                                                      281 - 284
//

Text Mined References (8)

PMID Year Title
26888608 2016 A tRNA methyltransferase paralog is important for ribosome stability and cell division in Trypanosoma brucei.
18759275 2008 Association of a common nonsynonymous variant in GLUT9 with serum uric acid levels in old order amish.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.