Property Summary

NCBI Gene PubMed Count 13
PubMed Score 9.68
PubTator Score 356.02

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
25776761 IFI44 localizes to nuclei and suppresses HIV-1 LTR promoter.
24742347 HIV-1 and the viral protein Tat modulate the expression of interferon-inducible protein 44 (IFI44) in immature dendritic cells and monocyte-derived macrophages
24742347 HIV-1 and the viral protein Tat modulate the expression of interferon-inducible protein 44 (IFI44) in immature dendritic cells and monocyte-derived macrophages
22896602 The restriction of Bunyamwera virus replication mediated by interferon is an accumulated effect of at least three interferon-stimulated genes viperin, MTAP44 and PKR.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of interferon-induced protein 44 (IFI44) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18953482 Observational study of gene-disease association. (HuGE Navigator)
17784819 Binds and depletes intracellular GTP, abolishing extracellular signal-regulated kinase (ERK) signaling and resulting finally in cell cycle arrest.
16886895 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12539042 HIV-1 and the viral protein Tat modulate the expression of interferon-inducible protein 44 (IFI44) in immature dendritic cells and monocyte-derived macrophages

AA Sequence

MAVTTRLTWLHEKILQNHFGGKRLSLLYKGSVHGFRNGVLLDRCCNQGPTLTVIYSEDHIIGAYAEESYQ      1 - 70
EGKYASIILFALQDTKISEWKLGLCTPETLFCCDVTKYNSPTNFQIDGRNRKVIMDLKTMENLGLAQNCT     71 - 140
ISIQDYEVFRCEDSLDERKIKGVIELRKSLLSALRTYEPYGSLVQQIRILLLGPIGAGKSSFFNSVRSVF    141 - 210
QGHVTHQALVGTNTTGISEKYRTYSIRDGKDGKYLPFILCDSLGLSEKEGGLCRDDIFYILNGNIRDRYQ    211 - 280
FNPMESIKLNHHDYIDSPSLKDRIHCVAFVFDASSIQYFSSQMIVKIKRIRRELVNAGVVHVALLTHVDS    281 - 350
MDLITKGDLIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELDPVKDVLILSALRRMLWAADDF    351 - 420
LEDLPFEQIGNLREEIINCAQGKK                                                  421 - 444
//

Text Mined References (15)

PMID Year Title
25776761 2015 IFI44 suppresses HIV-1 LTR promoter activity and facilitates its latency.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
22896602 2012 Viperin, MTAP44, and protein kinase R contribute to the interferon-induced inhibition of Bunyamwera Orthobunyavirus replication.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18953482 2008 Polymorphisms of interferons and their receptors in the genetics of severe RSV-associated diseases.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17784819 2007 Antiproliferative activity of the human IFN-alpha-inducible protein IFI44.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16886895 2006 Genetic predisposition of responsiveness to therapy for chronic hepatitis C.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...