Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.83
PubTator Score 1.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Dermatitis, Atopic 37 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Atopic dermatitis 952 3.784 1.9

Gene RIF (2)

AA Sequence

MDASRPKSSESQSSLEAPRPGPNPSPNVVNKPLQRDFPGMVADRLPPKTGVVVIDMGTGTCKVGFAGQAS      1 - 70
PTYTVATILGCQPKKPATSGQSGLQTFIGEAARVLPELTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVA     71 - 140
THDHPLLFSDPPFSPATNREKLVEVAFESLRSPAMYVASQSVLSVYAHGRVSGLVVDTGHGVTYTVPVFQ    141 - 210
GYNLLHATERLDLAGNHLTAFLAEMLLQAGLPLGQQDLDLVENIKHHYCYVASDFQKEQARPEQEYKRTL    211 - 280
KLPDGRTVTLGKELFQCPELLFNPPEVPGLSPVGLSTMAKQSLRKLSLEMRADLAQNVLLCGGSSLFTGF    281 - 350
EGRFRAELLRALPAETHVVVAAQPTRNFSVWIGGSILASLRAFQSCWVLREQYEEQGPYIVYRKCY        351 - 416
//

Text Mined References (9)

PMID Year Title