Property Summary

NCBI Gene PubMed Count 18
Grant Count 9
R01 Count 6
Funding $1,764,461.5
PubMed Score 9.05
PubTator Score 24.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.100 0.028
glioblastoma -1.400 0.006
pediatric high grade glioma -1.100 0.005
Pick disease -1.100 0.003
ovarian cancer -1.100 0.000
pituitary cancer 1.600 0.001
chronic rhinosinusitis -1.087 0.005

Gene RIF (4)

PMID Text
23939472 We verified that NRF-1 positively regulates FAM134C and ENOX1, and negatively regulates C3orf10 in human neuroblastoma IMR-32 cells and primary rat cortical neurons.
22744667 These results indicate that this sequence variant in ENOX1 may contribute to the familial autoimmune myasthenia in these patients.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19055324 copper-binding capacity, enzymatic activity, and time-keeping (clock) properties

AA Sequence

MVDAGGVENITQLPQELPQMMAAAADGLGSIAIDTTQLNMSVTDPTAWATAMNNLGMVPVGLPGQQLVSD      1 - 70
SICVPGFDPSLNMMTGITPINPMIPGLGLVPPPPPTEVAVVKEIIHCKSCTLFPQNPNLPPPSTRERPPG     71 - 140
CKTVFVGGLPENATEEIIQEVFEQCGDITAIRKSKKNFCHIRFAEEFMVDKAIYLSGYRMRLGSSTDKKD    141 - 210
SGRLHVDFAQARDDFYEWECKQRMRAREERHRRKLEEDRLRPPSPPAIMHYSEHEAALLAEKLKDDSKFS    211 - 280
EAITVLLSWIERGEVNRRSANQFYSMVQSANSHVRRLMNEKATHEQEMEEAKENFKNALTGILTQFEQIV    281 - 350
AVFNASTRQKAWDHFSKAQRKNIDIWRKHSEELRNAQSEQLMGIRREEEMEMSDDENCDSPTKKMRVDES    351 - 420
ALAAQAYALKEENDSLRWQLDAYRNEVELLKQEKEQLFRTEENLTKDQQLQFLQQTMQGMQQQLLTIQEE    421 - 490
LNNKKSELEQAKEEQSHTQALLKVLQEQLKGTKELVETNGHSHEDSNEINVLTVALVNQDRENNIEKRSQ    491 - 560
GLKSEKEALLIGIISTFLHVHPFGANIEYLWSYMQQLDSKISANEIEMLLMRLPRMFKQEFTGVGATLEK    561 - 630
RWKLCAFEGIKTT                                                             631 - 643
//

Text Mined References (22)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
23939472 2013 Novel genes FAM134C, C3orf10 and ENOX1 are regulated by NRF-1 and differentially regulate neurite outgrowth in neuroblastoma cells and hippocampal neurons.
23381943 2013 Ischemic stroke is associated with the ABO locus: the EuroCLOT study.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
22744667 2012 A candidate gene for autoimmune myasthenia gravis.
22491018 2013 Genome-wide association analysis implicates the involvement of eight loci with response to tocilizumab for the treatment of rheumatoid arthritis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19055324 2008 Molecular cloning and characterization of a candidate human growth-related and time-keeping constitutive cell surface hydroquinone (NADH) oxidase.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...