Property Summary

NCBI Gene PubMed Count 18
PubMed Score 9.05
PubTator Score 24.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Major Depressive Disorder 106
Disease Target Count P-value
ovarian cancer 8492 2.37043814040695E-9
pituitary cancer 1972 0.00134124387462189
Pick disease 1893 0.00305725685773612
pediatric high grade glioma 2712 0.00477775801739955
chronic rhinosinusitis 512 0.00505191012852601
glioblastoma 5572 0.00592150084284742
astrocytic glioma 2241 0.0277158727922005
Disease Target Count Z-score Confidence
Mental depression 58 0.0 2.0
Rheumatoid Arthritis 1171 0.0 2.0

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.100 0.028
glioblastoma -1.400 0.006
pediatric high grade glioma -1.100 0.005
Pick disease -1.100 0.003
ovarian cancer -1.100 0.000
pituitary cancer 1.600 0.001
chronic rhinosinusitis -1.087 0.005

Synonym

Accession Q8TC92 A4GU15 A6NMH9 B7Z5K1 Q2TU81 Q5VT11 Q9NWE0
Symbols CNOX
PIG38
cCNOX
bA64J21.1

Gene

PANTHER Protein Class (2)

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (4)

PMID Text
23939472 We verified that NRF-1 positively regulates FAM134C and ENOX1, and negatively regulates C3orf10 in human neuroblastoma IMR-32 cells and primary rat cortical neurons.
22744667 These results indicate that this sequence variant in ENOX1 may contribute to the familial autoimmune myasthenia in these patients.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19055324 copper-binding capacity, enzymatic activity, and time-keeping (clock) properties

AA Sequence

MVDAGGVENITQLPQELPQMMAAAADGLGSIAIDTTQLNMSVTDPTAWATAMNNLGMVPVGLPGQQLVSD      1 - 70
SICVPGFDPSLNMMTGITPINPMIPGLGLVPPPPPTEVAVVKEIIHCKSCTLFPQNPNLPPPSTRERPPG     71 - 140
CKTVFVGGLPENATEEIIQEVFEQCGDITAIRKSKKNFCHIRFAEEFMVDKAIYLSGYRMRLGSSTDKKD    141 - 210
SGRLHVDFAQARDDFYEWECKQRMRAREERHRRKLEEDRLRPPSPPAIMHYSEHEAALLAEKLKDDSKFS    211 - 280
EAITVLLSWIERGEVNRRSANQFYSMVQSANSHVRRLMNEKATHEQEMEEAKENFKNALTGILTQFEQIV    281 - 350
AVFNASTRQKAWDHFSKAQRKNIDIWRKHSEELRNAQSEQLMGIRREEEMEMSDDENCDSPTKKMRVDES    351 - 420
ALAAQAYALKEENDSLRWQLDAYRNEVELLKQEKEQLFRTEENLTKDQQLQFLQQTMQGMQQQLLTIQEE    421 - 490
LNNKKSELEQAKEEQSHTQALLKVLQEQLKGTKELVETNGHSHEDSNEINVLTVALVNQDRENNIEKRSQ    491 - 560
GLKSEKEALLIGIISTFLHVHPFGANIEYLWSYMQQLDSKISANEIEMLLMRLPRMFKQEFTGVGATLEK    561 - 630
RWKLCAFEGIKTT                                                             631 - 643
//

Text Mined References (22)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
23939472 2013 Novel genes FAM134C, C3orf10 and ENOX1 are regulated by NRF-1 and differentially regulate neurite outgrowth in neuroblastoma cells and hippocampal neurons.
23381943 2013 Ischemic stroke is associated with the ABO locus: the EuroCLOT study.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
22744667 2012 A candidate gene for autoimmune myasthenia gravis.
22491018 2013 Genome-wide association analysis implicates the involvement of eight loci with response to tocilizumab for the treatment of rheumatoid arthritis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19055324 2008 Molecular cloning and characterization of a candidate human growth-related and time-keeping constitutive cell surface hydroquinone (NADH) oxidase.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...